Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Location of monoclonal antibody binding sites in the capsid protein of feline calicivirus.

    ID: 1379634

    Description: epitope description:DTTIPGELIPAGDYAITNGTGNDITTATGYDTADIIK antigen name:Capsid protein host organism:Mus musculus antibody name:4E7

    Publication: 1383410;

  2. Identification of the core residues of the epitope of a monoclonal antibody raised against glycoprotein D of herpes simplex virus type 1 by screening ...

    ID: 1379636

    Description: epitope description:FFHNGRFSDALRFTL host organism:Mus musculus BALB/c antibody name:A16

    Publication: 7805747;

  3. Identification of the core residues of the epitope of a monoclonal antibody raised against glycoprotein D of herpes simplex virus type 1 by screening ...

    ID: 1379638

    Description: epitope description:FFHNGRFSDALRFTL host organism:Mus musculus BALB/c antibody name:A16

    Publication: 7805747;

  4. Characterization of human monoclonal antibodies directed against the pp65-kD matrix antigen of human cytomegalovirus.

    ID: 1379663

    Description: epitope description:KPGKIS antigen name:65 kDa phosphoprotein host organism:Homo sapiens antibody name:MO58

    Publication: 1710548;

  5. Characterization of human monoclonal antibodies directed against the pp65-kD matrix antigen of human cytomegalovirus.

    ID: 1379664

    Description: epitope description:KPGKIS antigen name:65 kDa phosphoprotein host organism:Homo sapiens antibody name:MO58

    Publication: 1710548;

  6. Direct lysis of Trypanosoma cruzi: a novel effector mechanism of protection mediated by human anti-gal antibodies.

    ID: 1379666

    Description: epitope description:alpha-D-galactosyl-(1->3)-D-galactosyl group antigen name:polysaccharide host organism:Homo sapiens

    Publication: 1717927;

  7. Characterization of human monoclonal antibodies directed against the pp65-kD matrix antigen of human cytomegalovirus.

    ID: 1379669

    Description: epitope description:M208, E209, N210, T211, R212, A213, T214, K215, M216, M280, I281, I282, K283, P284, G285 antigen name:65 kDa phosphoprotein host o...

    Publication: 1710548;

  8. Widespread reactivity of human sera with a variant repeat of the circumsporozoite protein of Plasmodium vivax.

    ID: 1379673

    Description: epitope description:ANGAGNQPGANGAGNQPGANGAGNQPGANGAGNQPG antigen name:Circumsporozoite protein, putative host organism:Mus musculus

    Publication: 2122747;

  9. Epitope changes on the haemagglutinin molecule of recently isolated H1N1 influenza viruses.

    ID: 1379679

    Description: epitope description:R125 antigen name:Hemagglutinin host organism:Mus musculus antibody name:mAb 110

    Publication: 1703564;

  10. Antibodies to hepatitis B surface antigen (HBsAg) elicited by immunization with a synthetic peptide covalently linked to liposomes.

    ID: 1379684

    Description: epitope description:PSCCCTKPSDGNCTCIPIPSS antigen name:Large envelope protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 6202827;

  11. Widespread reactivity of human sera with a variant repeat of the circumsporozoite protein of Plasmodium vivax.

    ID: 1379689

    Description: epitope description:NAAGNAAGNAAGNAAG antigen name:Circumsporozoite protein host organism:Mus musculus A/J

    Publication: 2122747;

  12. Widespread reactivity of human sera with a variant repeat of the circumsporozoite protein of Plasmodium vivax.

    ID: 1379690

    Description: epitope description:NAAGNAAGNAAGNAAG antigen name:Circumsporozoite protein host organism:Mus musculus

    Publication: 2122747;

  13. A novel recombinant multiepitope protein as a hepatitis C diagnostic intermediate of high sensitivity and specificity.

    ID: 1379700

    Description: epitope description:MSTLPKPQRQTKRNTPRRPQNVKFPGGGQIVGGVYVLPRRGPRL antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 16504539;

  14. Monoclonal antibodies to hepatitis B surface antigen (HBsAg) with anti-alpha specificity recognize a synthetic peptide analogue (S135-155) with unmodi...

    ID: 1379750

    Description: epitope description:PSCCCTKPSDGNCTCIPIPSS antigen name:Large envelope protein host organism:Mus musculus BALB/c antibody name:anti-a group mAb 5D3

    Publication: 6442302;

  15. Isotype-specific immune response to a single hepatitis C virus core epitope defined by a human monoclonal antibody: diagnostic value and correlation t...

    ID: 1379756

    Description: epitope description:VYLLPR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8086507;

  16. Characterization of a natural human antibody with anti-galactosyl(alpha 1-2)galactose specificity that is present at high titers in chronic Trypanosom...

    ID: 1379789

    Description: epitope description:alpha-D-galactosyl-(1->2)-D-galactosyl group antigen name:N-glycan host organism:Homo sapiens

    Publication: 1279994;

  17. Chemically synthesized peptides elicit neutralizing antibody to bovine enterovirus.

    ID: 1379803

    Description: epitope description:TSITHWRIDF antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:mouse sera

    Publication: 1689368;

  18. Chemically synthesized peptides elicit neutralizing antibody to bovine enterovirus.

    ID: 1379806

    Description: epitope description:PSNQDSFQWQ antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:mouse sera

    Publication: 1689368;

  19. Chemically synthesized peptides elicit neutralizing antibody to bovine enterovirus.

    ID: 1379815

    Description: epitope description:VSVQDALDAQ antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:mouse sera

    Publication: 1689368;

  20. Use of synthetic peptides in the study of the antibody response to Plasmodium vivax sporozoites.

    ID: 1379852

    Description: epitope description:DGQPAGDRADGQPAGDRA antigen name:Circumsporozoite protein, putative host organism:Mus musculus antibody name:Mab 2F2

    Publication: 1689124;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston