Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Linear peptide specificity of bovine antibody responses to p67 of Theileria parva and sequence diversity of sporozoite-neutralizing epitopes: implicat...

    ID: 1489025

    Description: epitope description:ELKKFLFEELESLVN antigen name:P67 protein host organism:Bos taurus antibody name:bovine anti-p67 sera

    Publication: 10024569;

  2. Linear peptide specificity of bovine antibody responses to p67 of Theileria parva and sequence diversity of sporozoite-neutralizing epitopes: implicat...

    ID: 1489028

    Description: epitope description:ASDFVEITDGLRKNT antigen name:P67 protein host organism:Bos taurus antibody name:bovine anti-p67 sera

    Publication: 10024569;

  3. Linear peptide specificity of bovine antibody responses to p67 of Theileria parva and sequence diversity of sporozoite-neutralizing epitopes: implicat...

    ID: 1489040

    Description: epitope description:ANELLLAMEKIVVPP antigen name:P67 protein host organism:Bos taurus antibody name:bovine anti-p67 sera

    Publication: 10024569;

  4. Linear peptide specificity of bovine antibody responses to p67 of Theileria parva and sequence diversity of sporozoite-neutralizing epitopes: implicat...

    ID: 1489044

    Description: epitope description:IAYYATKDILSSIEN antigen name:P67 protein host organism:Bos taurus antibody name:bovine anti-p67 sera

    Publication: 10024569;

  5. Linear peptide specificity of bovine antibody responses to p67 of Theileria parva and sequence diversity of sporozoite-neutralizing epitopes: implicat...

    ID: 1489048

    Description: epitope description:QVRNSLRMVPHQMNL antigen name:P67 protein host organism:Bos taurus antibody name:bovine anti-p67 sera

    Publication: 10024569;

  6. Linear peptide specificity of bovine antibody responses to p67 of Theileria parva and sequence diversity of sporozoite-neutralizing epitopes: implicat...

    ID: 1489051

    Description: epitope description:SDMMRRRGTASQDEP antigen name:P67 protein host organism:Bos taurus antibody name:bovine anti-p67 sera

    Publication: 10024569;

  7. Linear peptide specificity of bovine antibody responses to p67 of Theileria parva and sequence diversity of sporozoite-neutralizing epitopes: implicat...

    ID: 1489052

    Description: epitope description:TASQDEPAGAGSGVT antigen name:P67 protein host organism:Bos taurus antibody name:bovine anti-p67 sera

    Publication: 10024569;

  8. Identification of amino acid residues important to the neuraminidase activity of the HN glycoprotein of Newcastle disease virus.

    ID: 1489056

    Description: epitope description:H200 antigen name:Hemagglutinin-neuraminidase host organism:Mus musculus BALB/c antibody name:HN23a, HN23c, HN23d, HN23d, HN23e, H...

    Publication: 2479168;

  9. Linear peptide specificity of bovine antibody responses to p67 of Theileria parva and sequence diversity of sporozoite-neutralizing epitopes: implicat...

    ID: 1489063

    Description: epitope description:KLKKKLLGSGFEVAS antigen name:P67 protein host organism:Bos taurus antibody name:bovine anti-p67 sera

    Publication: 10024569;

  10. A protective anti-peptide antibody against the immunodominant site of the A24 Cruzeiro strain of foot-and-mouth disease virus and its reactivity with ...

    ID: 1489079

    Description: epitope description:GSLAAR antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:C1.1

    Publication: 8609466;

  11. Antigenic structure analysis of glycosylated protein 3 of porcine reproductive and respiratory syndrome virus.

    ID: 1489085

    Description: epitope description:DELGFMVPPGLSSE antigen name:Glycoprotein 3 host organism:Sus scrofa

    Publication: 16384621;

  12. Antigenic structure analysis of glycosylated protein 3 of porcine reproductive and respiratory syndrome virus.

    ID: 1489091

    Description: epitope description:YEPGRSLW antigen name:Glycoprotein 3 host organism:Mus musculus BALB/c antibody name:31A2, 32D4, 32H7

    Publication: 16384621;

  13. Mapping of B-cell epitopes of hemagglutinin protein of rinderpest virus.

    ID: 1489157

    Description: epitope description:ECFPWDRKL antigen name:Hemagglutinin glycoprotein host organism:Mus musculus BALB/c antibody name:E2G4

    Publication: 12127784;

  14. Major linear IgE epitopes of mountain cedar pollen allergen Jun a 1 map to the pectate lyase catalytic site.

    ID: 1489182

    Description: epitope description:QNRMKLADCAVGF antigen name:Jun a 1 host organism:Homo sapiens

    Publication: 14563374;

  15. Major linear IgE epitopes of mountain cedar pollen allergen Jun a 1 map to the pectate lyase catalytic site.

    ID: 1489186

    Description: epitope description:KGGDFYTVTSTDD antigen name:Jun a 1 host organism:Homo sapiens

    Publication: 14563374;

  16. Peptide-specific antibodies as probes of the topography of the voltage-gated channel in the mitochondrial outer membrane of Neurospora crassa.

    ID: 1496446

    Description: epitope description:MAVPAFSDIAKSANDLLNKD antigen name:Mitochondrial outer membrane protein porin host organism:Oryctolagus cuniculus

    Publication: 7542652;

  17. Determination of neutralizing epitopes in variable domains I and IV of the major outer-membrane protein from Chlamydia trachomatis serovar K.

    ID: 1496488

    Description: epitope description:LDVTTLNPTI host organism:Mus musculus BALB/c antibody name:5C2, DP10

    Publication: 7524957;

  18. Influence of epitope polarity and adjuvants on the immunogenicity and efficacy of a synthetic peptide vaccine against Semliki Forest virus.

    ID: 1496508

    Description: epitope description:GREKFTIRPHYGKEIPFVPRADEPARKGKVH host organism:Mus musculus BALB/c

    Publication: 7690411;

  19. Influence of epitope polarity and adjuvants on the immunogenicity and efficacy of a synthetic peptide vaccine against Semliki Forest virus.

    ID: 1496518

    Description: epitope description:PFVPRADEPARKGKVHGREKFTIRPHYGKEI host organism:Mus musculus BALB/c

    Publication: 7690411;

  20. A novel multi-antigen virally vectored vaccine against Mycobacterium avium subspecies paratuberculosis.

    ID: 1496608

    Description: epitope description:FFWPKDFTFVCPTEI antigen name:AhpC host organism:Mus musculus C57BL/6

    Publication: 18043737;

  21. The effect of orientation within a chimeric peptide on the immunogenicity of Chlamydia trachomatis epitopes.

    ID: 1496610

    Description: epitope description:SATAIFDTTTLNPTIAG antigen name:Major outer membrane porin, serovar D host organism:Mus musculus C57BL/10

    Publication: 8676884;

  22. A novel multi-antigen virally vectored vaccine against Mycobacterium avium subspecies paratuberculosis.

    ID: 1496621

    Description: epitope description:QVLGVSIDSEFVHFN antigen name:AhpC host organism:Mus musculus C57BL/6

    Publication: 18043737;

  23. The effect of orientation within a chimeric peptide on the immunogenicity of Chlamydia trachomatis epitopes.

    ID: 1496631

    Description: epitope description:VAGLQNDPT host organism:Mus musculus C57BL/10

    Publication: 8676884;

  24. A novel multi-antigen virally vectored vaccine against Mycobacterium avium subspecies paratuberculosis.

    ID: 1496635

    Description: epitope description:LPFPMLSDIKRELSL antigen name:AhpC host organism:Mus musculus C57BL/6

    Publication: 18043737;

  25. A novel multi-antigen virally vectored vaccine against Mycobacterium avium subspecies paratuberculosis.

    ID: 1496643

    Description: epitope description:ADRATFIVDPNNEIQ antigen name:AhpC host organism:Mus musculus C57BL/6

    Publication: 18043737;

  26. Peptide-specific antibodies as probes of the topography of the voltage-gated channel in the mitochondrial outer membrane of Neurospora crassa.

    ID: 1496671

    Description: epitope description:MAVPAFSDIAKSANDLLNKD antigen name:Mitochondrial outer membrane protein porin host organism:Oryctolagus cuniculus

    Publication: 7542652;

  27. Identification of surface-exposed B-cell epitopes recognized by Haemophilus influenzae type b P1-specific monoclonal antibodies.

    ID: 1496715

    Description: epitope description:VKTIGDKRTLTLNTTANYT antigen name:Outer membrane protein P1 host organism:Mus musculus BALB/c antibody name:3E12

    Publication: 7682997;

  28. Naturally occurring MHR variants in Turkish patients infected with hepatitis B virus.

    ID: 1496732

    Description: epitope description:S143 antigen name:Large envelope protein host organism:Mus musculus antibody name:Vitros ECi/HBsAg

    Publication: 18205223;

  29. Characterization of cross-reactive and serotype-specific epitopes on the nucleocapsid proteins of hantaviruses.

    ID: 1496733

    Description: epitope description:QLVTARQKLKDAEKAVEVDPDDVNKSTLQNRRAAVSTLETKLG antigen name:Andes orthohantavirus protein host organism:Mus musculus antibody name:7E...

    Publication: 18342973;

  30. Antigenic sites on porin of Haemophilus influenzae type b: mapping with synthetic peptides and evaluation of structure predictions.

    ID: 1496783

    Description: epitope description:DKEYGVLNNSD antigen name:Outer membrane protein P2 host organism:Mus musculus BALB/c antibody name:POR.1

    Publication: 1375930;

  31. Location of the epitope recognized by monoclonal antibody 63G on the primary structure of human respiratory syncytial virus G glycoprotein and the abi...

    ID: 1496789

    Description: epitope description:KRIPNKKPGKKTTT antigen name:Major surface glycoprotein G host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1383397;

  32. Peptide-specific antibodies as probes of the topography of the voltage-gated channel in the mitochondrial outer membrane of Neurospora crassa.

    ID: 1496796

    Description: epitope description:HKVNSQVEAGSKATWN antigen name:Mitochondrial outer membrane protein porin host organism:Oryctolagus cuniculus

    Publication: 7542652;

  33. Peptide-specific antibodies as probes of the topography of the voltage-gated channel in the mitochondrial outer membrane of Neurospora crassa.

    ID: 1496797

    Description: epitope description:HKVNSQVEAGSKATWN antigen name:Mitochondrial outer membrane protein porin host organism:Oryctolagus cuniculus

    Publication: 7542652;

  34. Peptide-specific antibodies as probes of the topography of the voltage-gated channel in the mitochondrial outer membrane of Neurospora crassa.

    ID: 1496800

    Description: epitope description:THKVGTSFTFES antigen name:Mitochondrial outer membrane protein porin host organism:Oryctolagus cuniculus

    Publication: 7542652;

  35. Peptide-specific antibodies as probes of the topography of the voltage-gated channel in the mitochondrial outer membrane of Neurospora crassa.

    ID: 1496801

    Description: epitope description:THKVGTSFTFES antigen name:Mitochondrial outer membrane protein porin host organism:Oryctolagus cuniculus

    Publication: 7542652;

  36. Location of the epitope recognized by monoclonal antibody 63G on the primary structure of human respiratory syncytial virus G glycoprotein and the abi...

    ID: 1496802

    Description: epitope description:KRIPNKKPGKKTTT antigen name:Major surface glycoprotein G host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1383397;

  37. Location of the epitope recognized by monoclonal antibody 63G on the primary structure of human respiratory syncytial virus G glycoprotein and the abi...

    ID: 1496807

    Description: epitope description:KPTKKPTFKTTKKDLKPQ antigen name:Major surface glycoprotein G host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1383397;

  38. Location of the epitope recognized by monoclonal antibody 63G on the primary structure of human respiratory syncytial virus G glycoprotein and the abi...

    ID: 1496808

    Description: epitope description:KPTKKPTFKTTKKDLKPQ antigen name:Major surface glycoprotein G host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1383397;

  39. Location of the epitope recognized by monoclonal antibody 63G on the primary structure of human respiratory syncytial virus G glycoprotein and the abi...

    ID: 1496811

    Description: epitope description:KPTTKQRQNKPPNKPN antigen name:Major surface glycoprotein G host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1383397;

  40. Antigenic sites on porin of Haemophilus influenzae type b: mapping with synthetic peptides and evaluation of structure predictions.

    ID: 1496827

    Description: epitope description:DKEYGVLNNSD antigen name:Outer membrane protein P2 host organism:Mus musculus BALB/c antibody name:POR.1

    Publication: 1375930;

  41. Antigenic sites on porin of Haemophilus influenzae type b: mapping with synthetic peptides and evaluation of structure predictions.

    ID: 1496833

    Description: epitope description:KRPNDKAG antigen name:Outer membrane protein P2 host organism:Mus musculus BALB/c antibody name:POR.5

    Publication: 1375930;

  42. Antigenic sites on porin of Haemophilus influenzae type b: mapping with synthetic peptides and evaluation of structure predictions.

    ID: 1496835

    Description: epitope description:TTETGKGV antigen name:Outer membrane protein P2 host organism:Mus musculus BALB/c antibody name:POR.6

    Publication: 1375930;

  43. IgE binding structures of the major house dust mite allergen Der p I.

    ID: 1496859

    Description: epitope description:TNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAHRNQSLD antigen name:Der p 1 host organism:Homo sapiens

    Publication: 1371823;

  44. Localization of conserved B-cell epitopes among encapsulated and non-encapsulated Haemophilus influenzae P2 porin proteins using synthetic peptides.

    ID: 1496939

    Description: epitope description:VDNQKQQHGALRNQGSRFHIKATHNFGD antigen name:Outer membrane protein P2 host organism:Mus musculus BALB/c antibody name:P2-17

    Publication: 1372928;

  45. Studies on the primary structure and antigenic determinants of pilin isolated from Pseudomonas aeruginosa K.

    ID: 1497041

    Description: epitope description:EVPLGVAADANK antigen name:Other Pseudomonas aeruginosa protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2410087;

  46. Different rhinovirus serotypes neutralized by antipeptide antibodies.

    ID: 1497149

    Description: epitope description:KLILAYTPPGARGPQD antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 2444889;

  47. Different rhinovirus serotypes neutralized by antipeptide antibodies.

    ID: 1497155

    Description: epitope description:KLILAYTPPGARGPQD antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 2444889;

  48. Syntheses of immunodominant peptide regions of hepatitis C viral pathogens using PS-BDODMA resin: a single peptide derived from the conserved domain (...

    ID: 1497221

    Description: epitope description:HTPGCVPCVREGNSSRCWVALTPTLVA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 11168897;

  49. Antigen-antibody interactions: elucidation of the epitope and strain-specificity of a monoclonal antibody directed against the pilin protein adherence...

    ID: 1497223

    Description: epitope description:DNKYLPK antigen name:UniProt:M9S5B0 host organism:Mus musculus BALB/c antibody name:PK99H

    Publication: 1284654;

  50. Antigen-antibody interactions: elucidation of the epitope and strain-specificity of a monoclonal antibody directed against the pilin protein adherence...

    ID: 1497225

    Description: epitope description:DAKFRPN antigen name:UniProt:W5V4N0 host organism:Mus musculus BALB/c antibody name:PK99H

    Publication: 1284654;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston