Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Selective and efficient immunoprecipitation of the disease-associated form of the prion protein can be mediated by nonspecific interactions between mo...

    ID: 1274827

    Description: epitope description:HMAGAAAA antigen name:Major prion protein host organism:Mus musculus Biozzi antibody name:Pri-308

    Publication: 15140886;

  2. Selective and efficient immunoprecipitation of the disease-associated form of the prion protein can be mediated by nonspecific interactions between mo...

    ID: 1274828

    Description: epitope description:TQYERE antigen name:Major prion protein host organism:Mus musculus Biozzi antibody name:Pri-917

    Publication: 15140886;

  3. Localization of protective epitopes of the amino terminus of type 5 streptococcal M protein.

    ID: 1274833

    Description: epitope description:DLKTNNEGLK antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2422314;

  4. Localization of protective epitopes of the amino terminus of type 5 streptococcal M protein.

    ID: 1274834

    Description: epitope description:DLKTNNEGLK antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2422314;

  5. Epitope mapping of neutralizing botulinum neurotoxin A antibodies by phage display.

    ID: 1274837

    Description: epitope description:RGYMYLKGPRGSVMTTNIYLNSSLYRGTKFIIKKYASGNKDNIVRNNDRVYINVVVKNKEYRLATNASQAGVEKILSALEIPDVGNLSQVVVMKSKNDQGITNKCKMNLQDNNGNDIGFIGFHQFNNIAK...

    Publication: 11553596;

  6. Mapping of B-cell epitopes in the nucleocapsid protein of Puumala hantavirus.

    ID: 1274852

    Description: epitope description:SSLRYGNVLDVNAI antigen name:Puumala orthohantavirus protein host organism:Myodes glareolus antibody name:5E1

    Publication: 11952140;

  7. Mapping of B-cell epitopes in the nucleocapsid protein of Puumala hantavirus.

    ID: 1274858

    Description: epitope description:DDVNKNTLQARQQT antigen name:Puumala orthohantavirus protein host organism:Myodes glareolus antibody name:5B5

    Publication: 11952140;

  8. Mapping of B-cell epitopes in the nucleocapsid protein of Puumala hantavirus.

    ID: 1274863

    Description: epitope description:NKNTLQARQQTVSA antigen name:Puumala orthohantavirus protein host organism:Myodes glareolus antibody name:5B5

    Publication: 11952140;

  9. Mapping of B-cell epitopes in the nucleocapsid protein of Puumala hantavirus.

    ID: 1274865

    Description: epitope description:TKPTDPTGIEPDDH antigen name:Puumala orthohantavirus protein host organism:Myodes glareolus antibody name:5B5

    Publication: 11952140;

  10. Mapping of B-cell epitopes in the nucleocapsid protein of Puumala hantavirus.

    ID: 1274870

    Description: epitope description:IILKALYMLSTRGR antigen name:Puumala orthohantavirus protein host organism:Myodes glareolus antibody name:4E5

    Publication: 11952140;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston