Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Mapping of a conformational epitope shared between E1 and E2 on the serum-derived human hepatitis C virus envelope.

    ID: 1274558

    Description: epitope description:R297, H298, W299, T300, T301, Q302, G303, C304, N305, C306, P480, D481, Q482, R483, P484, Y485, C486, W487, H488, Y489, P490, P491...

    Publication: 12882983;

  2. Identification of two immunogenic domains of the prion protein--PrP--which activate class II-restricted T cells and elicit antibody responses against ...

    ID: 1274610

    Description: epitope description:NQVYYRPVDQYSNQNNFVHDCVNITIKQHT antigen name:Major prion protein host organism:Mus musculus PrP null

    Publication: 15075357;

  3. Selective and efficient immunoprecipitation of the disease-associated form of the prion protein can be mediated by nonspecific interactions between mo...

    ID: 1274623

    Description: epitope description:YEDRYYRE antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:SHA-31

    Publication: 15140886;

  4. Detection of species specific epitopes of mouse and hamster prion proteins (PrPs) by anti-peptide antibodies.

    ID: 1274658

    Description: epitope description:KPSKPKTNMKHMAGAA antigen name:Mesocricetus auratus (Syrian golden hamster) protein host organism:Oryctolagus cuniculus antibody na...

    Publication: 8645112;

  5. Detection of species specific epitopes of mouse and hamster prion proteins (PrPs) by anti-peptide antibodies.

    ID: 1274660

    Description: epitope description:ETDVKMMERV antigen name:Major prion protein host organism:Oryctolagus cuniculus antibody name:Ab. Mo-V

    Publication: 8645112;

  6. Detection of species specific epitopes of mouse and hamster prion proteins (PrPs) by anti-peptide antibodies.

    ID: 1274661

    Description: epitope description:ETDVKMMERV antigen name:Major prion protein host organism:Oryctolagus cuniculus antibody name:Ab. Mo-V

    Publication: 8645112;

  7. Preparation and characterization of antibodies against mouse prion protein (PrP) peptides.

    ID: 1274730

    Description: epitope description:VDQYSNQNNF antigen name:Major prion protein host organism:Oryctolagus cuniculus antibody name:Ab165-174

    Publication: 7535178;

  8. Preparation and characterization of antibodies against mouse prion protein (PrP) peptides.

    ID: 1274738

    Description: epitope description:CVTQYQKESQAYYD antigen name:Major prion protein host organism:Oryctolagus cuniculus antibody name:Ab213-226

    Publication: 7535178;

  9. Selection of antigenic and immunogenic mimics of hepatitis C virus using sera from patients.

    ID: 1274745

    Description: epitope description:PTHYISTSL host organism:Homo sapiens

    Publication: 8666827;

  10. Selection of antigenic and immunogenic mimics of hepatitis C virus using sera from patients.

    ID: 1274746

    Description: epitope description:PSHYVPRIY host organism:Homo sapiens

    Publication: 8666827;

  11. Selection of antigenic and immunogenic mimics of hepatitis C virus using sera from patients.

    ID: 1274749

    Description: epitope description:PTHYISSRH host organism:Mus musculus BALB/c

    Publication: 8666827;

  12. Selection of antigenic and immunogenic mimics of hepatitis C virus using sera from patients.

    ID: 1274752

    Description: epitope description:NKTKQNPNL host organism:Mus musculus BALB/c

    Publication: 8666827;

  13. Selection of antigenic and immunogenic mimics of hepatitis C virus using sera from patients.

    ID: 1274753

    Description: epitope description:NKTKQNPNL host organism:Homo sapiens

    Publication: 8666827;

  14. Selection of antigenic and immunogenic mimics of hepatitis C virus using sera from patients.

    ID: 1274755

    Description: epitope description:KLRRSTNWG host organism:Homo sapiens

    Publication: 8666827;

  15. Breaking immune tolerance to the prion protein using prion protein peptides plus oligodeoxynucleotide-CpG in mice.

    ID: 1274771

    Description: epitope description:DWEDRYYRENMYRYPNQVYYRPVDQYSN antigen name:Major prion protein host organism:Mus musculus C57BL/6

    Publication: 15100253;

  16. Breaking immune tolerance to the prion protein using prion protein peptides plus oligodeoxynucleotide-CpG in mice.

    ID: 1274776

    Description: epitope description:NQVYYRPVDQYSNQNNFVHDCVNITIKQHT antigen name:Major prion protein host organism:Mus musculus C57BL/6

    Publication: 15100253;

  17. Mapping of a conformational epitope shared between E1 and E2 on the serum-derived human hepatitis C virus envelope.

    ID: 1274781

    Description: epitope description:SPLRRHYELPLIQ host organism:Mus musculus BALB/c antibody name:D32.10

    Publication: 12882983;

  18. Mapping of a conformational epitope shared between E1 and E2 on the serum-derived human hepatitis C virus envelope.

    ID: 1274784

    Description: epitope description:SQRSRHWHDVPK host organism:Mus musculus BALB/c antibody name:D32.10

    Publication: 12882983;

  19. Mapping of a conformational epitope shared between E1 and E2 on the serum-derived human hepatitis C virus envelope.

    ID: 1274788

    Description: epitope description:WHRTPSTLWGVI host organism:Mus musculus BALB/c antibody name:D32.10

    Publication: 12882983;

  20. Mapping of a conformational epitope shared between E1 and E2 on the serum-derived human hepatitis C virus envelope.

    ID: 1274796

    Description: epitope description:HLYHKNRNHIAY host organism:Mus musculus BALB/c antibody name:D32.10

    Publication: 12882983;

  21. Selective and efficient immunoprecipitation of the disease-associated form of the prion protein can be mediated by nonspecific interactions between mo...

    ID: 1274827

    Description: epitope description:HMAGAAAA antigen name:Major prion protein host organism:Mus musculus Biozzi antibody name:Pri-308

    Publication: 15140886;

  22. Selective and efficient immunoprecipitation of the disease-associated form of the prion protein can be mediated by nonspecific interactions between mo...

    ID: 1274828

    Description: epitope description:TQYERE antigen name:Major prion protein host organism:Mus musculus Biozzi antibody name:Pri-917

    Publication: 15140886;

  23. Localization of protective epitopes of the amino terminus of type 5 streptococcal M protein.

    ID: 1274833

    Description: epitope description:DLKTNNEGLK antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2422314;

  24. Localization of protective epitopes of the amino terminus of type 5 streptococcal M protein.

    ID: 1274834

    Description: epitope description:DLKTNNEGLK antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2422314;

  25. Epitope mapping of neutralizing botulinum neurotoxin A antibodies by phage display.

    ID: 1274837

    Description: epitope description:RGYMYLKGPRGSVMTTNIYLNSSLYRGTKFIIKKYASGNKDNIVRNNDRVYINVVVKNKEYRLATNASQAGVEKILSALEIPDVGNLSQVVVMKSKNDQGITNKCKMNLQDNNGNDIGFIGFHQFNNIAK...

    Publication: 11553596;

  26. Mapping of B-cell epitopes in the nucleocapsid protein of Puumala hantavirus.

    ID: 1274852

    Description: epitope description:SSLRYGNVLDVNAI antigen name:Puumala orthohantavirus protein host organism:Myodes glareolus antibody name:5E1

    Publication: 11952140;

  27. Mapping of B-cell epitopes in the nucleocapsid protein of Puumala hantavirus.

    ID: 1274858

    Description: epitope description:DDVNKNTLQARQQT antigen name:Puumala orthohantavirus protein host organism:Myodes glareolus antibody name:5B5

    Publication: 11952140;

  28. Mapping of B-cell epitopes in the nucleocapsid protein of Puumala hantavirus.

    ID: 1274863

    Description: epitope description:NKNTLQARQQTVSA antigen name:Puumala orthohantavirus protein host organism:Myodes glareolus antibody name:5B5

    Publication: 11952140;

  29. Mapping of B-cell epitopes in the nucleocapsid protein of Puumala hantavirus.

    ID: 1274865

    Description: epitope description:TKPTDPTGIEPDDH antigen name:Puumala orthohantavirus protein host organism:Myodes glareolus antibody name:5B5

    Publication: 11952140;

  30. Mapping of B-cell epitopes in the nucleocapsid protein of Puumala hantavirus.

    ID: 1274870

    Description: epitope description:IILKALYMLSTRGR antigen name:Puumala orthohantavirus protein host organism:Myodes glareolus antibody name:4E5

    Publication: 11952140;

  31. Mapping of B-cell epitopes in the nucleocapsid protein of Puumala hantavirus.

    ID: 1274878

    Description: epitope description:RNKIYFMQRQDVLD antigen name:Puumala orthohantavirus protein host organism:Myodes glareolus antibody name:5F4

    Publication: 11952140;

  32. Selective and efficient immunoprecipitation of the disease-associated form of the prion protein can be mediated by nonspecific interactions between mo...

    ID: 1274886

    Description: epitope description:RESQAYYQR antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:Bar-234

    Publication: 15140886;

  33. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1274898

    Description: epitope description:DRGGRE antigen name:Large delta antigen host organism:Homo sapiens

    Publication: 1689390;

  34. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1274899

    Description: epitope description:RGGRED antigen name:Large delta antigen host organism:Homo sapiens

    Publication: 1689390;

  35. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1274904

    Description: epitope description:DILEQW antigen name:Large delta antigen host organism:Homo sapiens

    Publication: 1689390;

  36. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1274906

    Description: epitope description:LEQWVS antigen name:Large delta antigen host organism:Homo sapiens

    Publication: 1689390;

  37. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1274909

    Description: epitope description:WVSGRK antigen name:Large delta antigen host organism:Homo sapiens

    Publication: 1689390;

  38. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1274911

    Description: epitope description:SGRKKL antigen name:Large delta antigen host organism:Homo sapiens

    Publication: 1689390;

  39. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1274914

    Description: epitope description:KKLEEL antigen name:Large delta antigen host organism:Homo sapiens

    Publication: 1689390;

  40. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1274921

    Description: epitope description:RDLRKL antigen name:Large delta antigen host organism:Homo sapiens

    Publication: 1689390;

  41. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1274929

    Description: epitope description:KIKKLE antigen name:Large delta antigen host organism:Homo sapiens

    Publication: 1689390;

  42. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1274934

    Description: epitope description:EEDNPW antigen name:Large delta antigen host organism:Homo sapiens

    Publication: 1689390;

  43. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1274936

    Description: epitope description:DNPWLG antigen name:Large delta antigen host organism:Homo sapiens

    Publication: 1689390;

  44. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1274937

    Description: epitope description:NPWLGN antigen name:Large delta antigen host organism:Homo sapiens

    Publication: 1689390;

  45. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1274938

    Description: epitope description:PWLGNI antigen name:Large delta antigen host organism:Homo sapiens

    Publication: 1689390;

  46. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1274946

    Description: epitope description:IIGKKD antigen name:Large delta antigen host organism:Homo sapiens

    Publication: 1689390;

  47. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1274949

    Description: epitope description:KKDKDG antigen name:Large delta antigen host organism:Homo sapiens

    Publication: 1689390;

  48. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1274951

    Description: epitope description:DKDGEG antigen name:Large delta antigen host organism:Homo sapiens

    Publication: 1689390;

  49. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1274957

    Description: epitope description:APPAKK antigen name:Large delta antigen host organism:Homo sapiens

    Publication: 1689390;

  50. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1274958

    Description: epitope description:PPAKKL antigen name:Large delta antigen host organism:Homo sapiens

    Publication: 1689390;

  51. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1275094

    Description: epitope description:PFSPQS antigen name:Large delta antigen host organism:Homo sapiens

    Publication: 1689390;

  52. Identification of functional regions on the tail of Acanthamoeba myosin-II using recombinant fusion proteins. I. High resolution epitope mapping and c...

    ID: 1275116

    Description: epitope description:HADSSSRR antigen name:Myosin2 heavy chain, non muscle, putative host organism:Mus musculus C57BL/6 antibody name:M2.9

    Publication: 1703536;

  53. Identification of functional regions on the tail of Acanthamoeba myosin-II using recombinant fusion proteins. I. High resolution epitope mapping and c...

    ID: 1275118

    Description: epitope description:EASAARLEKERKNALDEVAQLTADLDAE antigen name:Myosin2 heavy chain, non muscle, putative host organism:Mus musculus C57BL/6 antibody na...

    Publication: 1703536;

  54. Identification of functional regions on the tail of Acanthamoeba myosin-II using recombinant fusion proteins. I. High resolution epitope mapping and c...

    ID: 1275120

    Description: epitope description:VAKETSDKQ antigen name:Myosin2 heavy chain, non muscle, putative host organism:Mus musculus C57BL/6 antibody name:M2.31

    Publication: 1703536;

  55. Identification of functional regions on the tail of Acanthamoeba myosin-II using recombinant fusion proteins. I. High resolution epitope mapping and c...

    ID: 1275123

    Description: epitope description:LQSELENAPKTGGASSEEVKRLEG antigen name:Myosin2 heavy chain, non muscle, putative host organism:Mus musculus C57BL/6 antibody name:M...

    Publication: 1703536;

  56. Identification of functional regions on the tail of Acanthamoeba myosin-II using recombinant fusion proteins. I. High resolution epitope mapping and c...

    ID: 1275124

    Description: epitope description:QVDETKR antigen name:Myosin2 heavy chain, non muscle, putative host organism:Mus musculus C57BL/6 antibody name:M2.38

    Publication: 1703536;

  57. Immune response to GOR, a marker for non-A, non-B hepatitis and its correlation with hepatitis C virus infection.

    ID: 1275129

    Description: epitope description:GRRGQKAKSNPNRPLPVPRNPCRGPSG antigen name:Exonuclease GOR host organism:Homo sapiens antibody name:Human patient serum

    Publication: 1383257;

  58. Identification of an immunodominant B cell epitope on the hepatitis C virus nonstructural region defined by human monoclonal antibodies.

    ID: 1275132

    Description: epitope description:DEMEECSQHLPYIEQGMMLA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 1717573;

  59. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1275142

    Description: epitope description:MSRSER antigen name:Large delta antigen host organism:Marmota monax

    Publication: 1689390;

  60. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1275143

    Description: epitope description:SRSERR antigen name:Large delta antigen host organism:Marmota monax

    Publication: 1689390;

  61. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1275150

    Description: epitope description:GGREDI antigen name:Large delta antigen host organism:Marmota monax

    Publication: 1689390;

  62. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1275158

    Description: epitope description:QWVSGR antigen name:Large delta antigen host organism:Marmota monax

    Publication: 1689390;

  63. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1275161

    Description: epitope description:SGRKKL antigen name:Large delta antigen host organism:Marmota monax

    Publication: 1689390;

  64. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1275168

    Description: epitope description:ELERDL antigen name:Large delta antigen host organism:Marmota monax

    Publication: 1689390;

  65. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1275172

    Description: epitope description:DLRKLK antigen name:Large delta antigen host organism:Marmota monax

    Publication: 1689390;

  66. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1275173

    Description: epitope description:LRKLKK antigen name:Large delta antigen host organism:Marmota monax

    Publication: 1689390;

  67. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1274977

    Description: epitope description:RPLRGG antigen name:Large delta antigen host organism:Homo sapiens

    Publication: 1689390;

  68. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1274987

    Description: epitope description:ERQDHR antigen name:Large delta antigen host organism:Homo sapiens

    Publication: 1689390;

  69. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1274988

    Description: epitope description:RQDHRR antigen name:Large delta antigen host organism:Homo sapiens

    Publication: 1689390;

  70. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1274992

    Description: epitope description:RRRKAL antigen name:Large delta antigen host organism:Homo sapiens

    Publication: 1689390;

  71. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1274996

    Description: epitope description:ALENKR antigen name:Large delta antigen host organism:Homo sapiens

    Publication: 1689390;

  72. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1274997

    Description: epitope description:LENKRK antigen name:Large delta antigen host organism:Homo sapiens

    Publication: 1689390;

  73. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1275000

    Description: epitope description:KRKQLS antigen name:Large delta antigen host organism:Homo sapiens

    Publication: 1689390;

  74. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1275003

    Description: epitope description:QLSSGG antigen name:Large delta antigen host organism:Homo sapiens

    Publication: 1689390;

  75. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1275006

    Description: epitope description:SGGKSL antigen name:Large delta antigen host organism:Homo sapiens

    Publication: 1689390;

  76. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1275008

    Description: epitope description:GKSLSR antigen name:Large delta antigen host organism:Homo sapiens

    Publication: 1689390;

  77. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1275009

    Description: epitope description:KSLSRE antigen name:Large delta antigen host organism:Homo sapiens

    Publication: 1689390;

  78. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1275016

    Description: epitope description:EEELKR antigen name:Large delta antigen host organism:Homo sapiens

    Publication: 1689390;

  79. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1275017

    Description: epitope description:EELKRL antigen name:Large delta antigen host organism:Homo sapiens

    Publication: 1689390;

  80. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1275027

    Description: epitope description:EKRERR antigen name:Large delta antigen host organism:Homo sapiens

    Publication: 1689390;

  81. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1275035

    Description: epitope description:GPSVGG antigen name:Large delta antigen host organism:Homo sapiens

    Publication: 1689390;

  82. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1275040

    Description: epitope description:GVNPLE antigen name:Large delta antigen host organism:Homo sapiens

    Publication: 1689390;

  83. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1275048

    Description: epitope description:SRGAPG antigen name:Large delta antigen host organism:Homo sapiens

    Publication: 1689390;

  84. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1275052

    Description: epitope description:PGGGFV antigen name:Large delta antigen host organism:Homo sapiens

    Publication: 1689390;

  85. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1275053

    Description: epitope description:GGGFVP antigen name:Large delta antigen host organism:Homo sapiens

    Publication: 1689390;

  86. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1275064

    Description: epitope description:PESPFA antigen name:Large delta antigen host organism:Homo sapiens

    Publication: 1689390;

  87. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1275067

    Description: epitope description:PFARTG antigen name:Large delta antigen host organism:Homo sapiens

    Publication: 1689390;

  88. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1275077

    Description: epitope description:IRGSQG antigen name:Large delta antigen host organism:Homo sapiens

    Publication: 1689390;

  89. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1275081

    Description: epitope description:QGFPWD antigen name:Large delta antigen host organism:Homo sapiens

    Publication: 1689390;

  90. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1275085

    Description: epitope description:WDILFP antigen name:Large delta antigen host organism:Homo sapiens

    Publication: 1689390;

  91. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1275087

    Description: epitope description:ILFPAD antigen name:Large delta antigen host organism:Homo sapiens

    Publication: 1689390;

  92. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1275088

    Description: epitope description:LFPADP antigen name:Large delta antigen host organism:Homo sapiens

    Publication: 1689390;

  93. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270531

    Description: epitope description:IERMKDTLRI antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  94. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270533

    Description: epitope description:RMKDTLRITY antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  95. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270536

    Description: epitope description:DTLRITYLTE antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  96. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270539

    Description: epitope description:RITYLTETKI antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  97. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270543

    Description: epitope description:LTETKIDKLC antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  98. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270552

    Description: epitope description:YLTETKIDKL antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  99. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270553

    Description: epitope description:LTETKIDKLC antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  100. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270554

    Description: epitope description:TETKIDKLCV antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston