Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. The major human structural IgE epitope of the Brazil nut allergen Ber e 1: a chimaeric and protein microarray approach.

    ID: 1497269

    Description: epitope description:NQEECREQMQRQQM antigen name:Ber e 1 host organism:Homo sapiens

    Publication: 15465060;

  2. The major human structural IgE epitope of the Brazil nut allergen Ber e 1: a chimaeric and protein microarray approach.

    ID: 1497270

    Description: epitope description:QMQRQQMLSHCRMY antigen name:Ber e 1 host organism:Homo sapiens

    Publication: 15465060;

  3. The major human structural IgE epitope of the Brazil nut allergen Ber e 1: a chimaeric and protein microarray approach.

    ID: 1497281

    Description: epitope description:MMMMRMQQEEMQPR antigen name:Ber e 1 host organism:Homo sapiens

    Publication: 15465060;

  4. The major human structural IgE epitope of the Brazil nut allergen Ber e 1: a chimaeric and protein microarray approach.

    ID: 1497283

    Description: epitope description:GEQMRRMMRLAENI antigen name:Ber e 1 host organism:Homo sapiens

    Publication: 15465060;

  5. The carboxyl terminal amino acid residues of Pseudomonas aeruginosa exotoxin A involved in cell toxicity and pathogenesis, characterized by a neutrali...

    ID: 1497322

    Description: epitope description:EQAISALPDYASQPGKPPREDLK antigen name:Exotoxin A host organism:Homo sapiens antibody name:HI-1A4

    Publication: 1719985;

  6. Epitope mapping of conformational monoclonal antibodies specific to NhaA Na+/H+ antiporter: structural and functional implications.

    ID: 1497330

    Description: epitope description:P320, E321, G322, T324, Y325, Q326 antigen name:Na(+)/H(+) antiporter NhaA host organism:Mus musculus BALB/c antibody name:5H4

    Publication: 18452948;

  7. Epitope mapping of conformational monoclonal antibodies specific to NhaA Na+/H+ antiporter: structural and functional implications.

    ID: 1497331

    Description: epitope description:D354, E356, L357 antigen name:Na(+)/H(+) antiporter NhaA host organism:Mus musculus BALB/c antibody name:2C5

    Publication: 18452948;

  8. Epitope mapping with solid-phase peptides: identification of type-, subspecies-, species- and genus-reactive antibody binding domains on the major out...

    ID: 1497339

    Description: epitope description:DVLQIAS antigen name:Major outer membrane porin host organism:Mus musculus antibody name:J50

    Publication: 2460719;

  9. The primary neutralization epitope of porcine respiratory and reproductive syndrome virus strain VR-2332 is located in the middle of the GP5 ectodomai...

    ID: 1497350

    Description: epitope description:AGDSSTKNLIYTSTLCELNV antigen name:major structural glycoprotein GP5 host organism:Sus scrofa

    Publication: 12491101;

  10. Epitope mapping the Fim2 and Fim3 proteins of Bordetella pertussis with sera from patients infected with or vaccinated against whooping cough.

    ID: 1497358

    Description: epitope description:KVVQLPKISKNALKANG antigen name:Serotype 2 fimbrial subunit host organism:Homo sapiens

    Publication: 8731026;

  11. Epitope mapping the Fim2 and Fim3 proteins of Bordetella pertussis with sera from patients infected with or vaccinated against whooping cough.

    ID: 1497362

    Description: epitope description:TGDLRAY antigen name:Serotype 2 fimbrial subunit host organism:Homo sapiens

    Publication: 8731026;

  12. Epitope mapping the Fim2 and Fim3 proteins of Bordetella pertussis with sera from patients infected with or vaccinated against whooping cough.

    ID: 1497364

    Description: epitope description:VQVRI antigen name:Serotype 2 fimbrial subunit host organism:Homo sapiens

    Publication: 8731026;

  13. Epitope mapping the Fim2 and Fim3 proteins of Bordetella pertussis with sera from patients infected with or vaccinated against whooping cough.

    ID: 1497366

    Description: epitope description:YFEPGPT antigen name:Serotype 2 fimbrial subunit host organism:Homo sapiens

    Publication: 8731026;

  14. Peptide vaccine against canine parvovirus: identification of two neutralization subsites in the N terminus of VP2 and optimization of the amino acid s...

    ID: 1497380

    Description: epitope description:DGAVQPDGG antigen name:Capsid protein VP1 host organism:Mus musculus BALB/c

    Publication: 7474152;

  15. Directed evolution of an anti-prion protein scFv fragment to an affinity of 1 pM and its structural interpretation.

    ID: 1497451

    Description: epitope description:THGQWNKPSK antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:P

    Publication: 16962610;

  16. Antibodies to envelope glycoprotein of dengue virus during the natural course of infection are predominantly cross-reactive and recognize epitopes con...

    ID: 1497470

    Description: epitope description:W101, L107, F108 antigen name:Genome polyprotein host organism:Mus musculus antibody name:4G2

    Publication: 18448542;

  17. Localization of group-specific epitopes on the major capsid protein of group A rotavirus.

    ID: 1497490

    Description: epitope description:TGGIGNLPIRNWNFDFG antigen name:Intermediate capsid protein VP6 host organism:Mus musculus BALB/c

    Publication: 1378880;

  18. Determination of neutralizing epitopes in variable domains I and IV of the major outer-membrane protein from Chlamydia trachomatis serovar K.

    ID: 1497499

    Description: epitope description:LQNDPTTNVA host organism:Mus musculus BALB/c antibody name:11A12, 2D7

    Publication: 7524957;

  19. Epitope mapping the Fim2 and Fim3 proteins of Bordetella pertussis with sera from patients infected with or vaccinated against whooping cough.

    ID: 1497556

    Description: epitope description:KVVQLPKISKNALKANG antigen name:Serotype 2 fimbrial subunit host organism:Homo sapiens

    Publication: 8731026;

  20. Epitope mapping the Fim2 and Fim3 proteins of Bordetella pertussis with sera from patients infected with or vaccinated against whooping cough.

    ID: 1497560

    Description: epitope description:TGDLRAY antigen name:Serotype 2 fimbrial subunit host organism:Homo sapiens

    Publication: 8731026;

  21. Epitope mapping the Fim2 and Fim3 proteins of Bordetella pertussis with sera from patients infected with or vaccinated against whooping cough.

    ID: 1497564

    Description: epitope description:ITTYV antigen name:Serotype 2 fimbrial subunit host organism:Homo sapiens

    Publication: 8731026;

  22. Substrate specificity of two thrombin like enzymes (elegaxobin, elegaxobin II) from the venom of Trimeresurus elegans (Sakishima-habu), using neutrali...

    ID: 1497594

    Description: epitope description:HSKKVPNKDRRRRVPKEKFFCDSSKNYTKWNKDI antigen name:Thrombin-like enzyme elegaxobin-2 host organism:Oryctolagus cuniculus antibody nam...

    Publication: 16938323;

  23. Substrate specificity of two thrombin like enzymes (elegaxobin, elegaxobin II) from the venom of Trimeresurus elegans (Sakishima-habu), using neutrali...

    ID: 1497615

    Description: epitope description:LIRLNRPVRKSAHIAPLSLPSSPPSVGSVCRIM antigen name:Thrombin-like enzyme elegaxobin-2 host organism:Oryctolagus cuniculus antibody name...

    Publication: 16938323;

  24. Substrate specificity of two thrombin like enzymes (elegaxobin, elegaxobin II) from the venom of Trimeresurus elegans (Sakishima-habu), using neutrali...

    ID: 1497645

    Description: epitope description:AQPHEPGSYTNVF antigen name:Thrombin-like enzyme elegaxobin-2 host organism:Oryctolagus cuniculus antibody name:anti-elegaxobin II ...

    Publication: 16938323;

  25. Substrate specificity of two thrombin like enzymes (elegaxobin, elegaxobin II) from the venom of Trimeresurus elegans (Sakishima-habu), using neutrali...

    ID: 1497646

    Description: epitope description:SWGGDPCAQPHEPGSYTNV antigen name:Thrombin-like enzyme elegaxobin-2 host organism:Oryctolagus cuniculus antibody name:anti-elegaxob...

    Publication: 16938323;

  26. Localization of group-specific epitopes on the major capsid protein of group A rotavirus.

    ID: 1497684

    Description: epitope description:NWNFD antigen name:Intermediate capsid protein VP6 host organism:Mus musculus antibody name:RV-50, RV-1026

    Publication: 1378880;

  27. Epitope mapping the Fim2 and Fim3 proteins of Bordetella pertussis with sera from patients infected with or vaccinated against whooping cough.

    ID: 1497713

    Description: epitope description:LKLYFEP antigen name:Serotype 3 fimbrial subunit host organism:Homo sapiens

    Publication: 8731026;

  28. Substrate specificity of two thrombin like enzymes (elegaxobin, elegaxobin II) from the venom of Trimeresurus elegans (Sakishima-habu), using neutrali...

    ID: 1497787

    Description: epitope description:GQSRKPGIYTKVFDYNAWIQ antigen name:Thrombin-like enzyme flavoxobin host organism:Oryctolagus cuniculus antibody name:anti-elegaxobi...

    Publication: 16938323;

  29. Epitope mapping the Fim2 and Fim3 proteins of Bordetella pertussis with sera from patients infected with or vaccinated against whooping cough.

    ID: 1497789

    Description: epitope description:SSATK antigen name:Serotype 3 fimbrial subunit host organism:Homo sapiens

    Publication: 8731026;

  30. Localization of group-specific epitopes on the major capsid protein of group A rotavirus.

    ID: 1497797

    Description: epitope description:IRNW antigen name:Intermediate capsid protein VP6 host organism:Mus musculus antibody name:RV-133

    Publication: 1378880;

  31. Localization of group-specific epitopes on the major capsid protein of group A rotavirus.

    ID: 1497823

    Description: epitope description:LLGTTLL antigen name:Intermediate capsid protein VP6 host organism:Mus musculus antibody name:RV-133

    Publication: 1378880;

  32. Epitope mapping the Fim2 and Fim3 proteins of Bordetella pertussis with sera from patients infected with or vaccinated against whooping cough.

    ID: 1497825

    Description: epitope description:IRMGTDK antigen name:Serotype 3 fimbrial subunit host organism:Homo sapiens

    Publication: 8731026;

  33. Epitope mapping the Fim2 and Fim3 proteins of Bordetella pertussis with sera from patients infected with or vaccinated against whooping cough.

    ID: 1497831

    Description: epitope description:ASYVKKPKEDVD antigen name:Serotype 3 fimbrial subunit host organism:Homo sapiens

    Publication: 8731026;

  34. Epitope mapping the Fim2 and Fim3 proteins of Bordetella pertussis with sera from patients infected with or vaccinated against whooping cough.

    ID: 1497852

    Description: epitope description:DLIAYKQ antigen name:Serotype 3 fimbrial subunit host organism:Homo sapiens

    Publication: 8731026;

  35. Contribution of influenza immunity and virosomal-formulated synthetic peptide to cellular immune responses in a phase I subunit malaria vaccine trial.

    ID: 1497987

    Description: epitope description:ANPNENPNANPNANPNANPN + MCM(5) host organism:Homo sapiens

    Publication: 18337175;

  36. Substrate specificity of two thrombin like enzymes (elegaxobin, elegaxobin II) from the venom of Trimeresurus elegans (Sakishima-habu), using neutrali...

    ID: 1497992

    Description: epitope description:LIRLDRPVRKSAHIAPLSLPSSPPSVGSVCRVM antigen name:Thrombin-like enzyme elegaxobin-1 host organism:Oryctolagus cuniculus antibody name...

    Publication: 16938323;

  37. Substrate specificity of two thrombin like enzymes (elegaxobin, elegaxobin II) from the venom of Trimeresurus elegans (Sakishima-habu), using neutrali...

    ID: 1497993

    Description: epitope description:VIGGDECNINEHPFLVLVYYDDYQCGGTLINEEWVLTAAHCNGKN antigen name:Thrombin-like enzyme elegaxobin-1 host organism:Oryctolagus cuniculus a...

    Publication: 16938323;

  38. Immunobiological activities of synthetic peptide segments of fimbrial protein from Porphyromonas gingivalis.

    ID: 1498016

    Description: epitope description:GKTLAEVKALTTELTAENQE antigen name:Major fimbrial subunit protein type-1 host organism:Oryctolagus cuniculus

    Publication: 1659412;

  39. Immunobiological activities of synthetic peptide segments of fimbrial protein from Porphyromonas gingivalis.

    ID: 1498022

    Description: epitope description:NYTPKNKIERNHKYDIKLTI antigen name:Major fimbrial subunit protein type-1 host organism:Oryctolagus cuniculus

    Publication: 1659412;

  40. Substrate specificity of two thrombin like enzymes (elegaxobin, elegaxobin II) from the venom of Trimeresurus elegans (Sakishima-habu), using neutrali...

    ID: 1498026

    Description: epitope description:VIGGDECNINEHPFLVLVYYDDYQCGGTLINEEWVLTAAHCDGKN antigen name:Other Protobothrops elegans (sakishima habu) protein host organism:Oryc...

    Publication: 16938323;

  41. Localization of a conserved epitope and an azurin-like domain in the H.8 protein of pathogenic Neisseria.

    ID: 1498058

    Description: epitope description:EATPAAEAPASEAPAAEAAP antigen name:Outer membrane protein H.8 host organism:Mus musculus BALB/c antibody name:H138.2

    Publication: 2452958;

  42. A monoclonal antibody that recognizes a potential coeliac-toxic repetitive pentapeptide epitope in gliadins.

    ID: 1498062

    Description: epitope description:QQPFP antigen name:Tri a 21 host organism:Mus musculus antibody name:R5

    Publication: 11711775;

  43. Identification of previously unknown antigenic epitopes on the S and N proteins of avian infectious bronchitis virus.

    ID: 1498070

    Description: epitope description:SGGKLVGILTSRNET antigen name:Spike glycoprotein host organism:Gallus gallus

    Publication: 15868095;

  44. Identification of previously unknown antigenic epitopes on the S and N proteins of avian infectious bronchitis virus.

    ID: 1498080

    Description: epitope description:NCPYVSYGKFCIKPDGSIST antigen name:Spike glycoprotein host organism:Gallus gallus

    Publication: 15868095;

  45. The major outer membrane protein of a single Chlamydia trachomatis serovar can possess more than one serovar-specific epitope.

    ID: 1498082

    Description: epitope description:GANTE antigen name:Major outer membrane porin host organism:Mus musculus BALB/c antibody name:F5/B7

    Publication: 8550205;

  46. Identification of previously unknown antigenic epitopes on the S and N proteins of avian infectious bronchitis virus.

    ID: 1498085

    Description: epitope description:VAAKGADTKSRSNQGTRD antigen name:Nucleoprotein host organism:Gallus gallus

    Publication: 15868095;

  47. Identification of previously unknown antigenic epitopes on the S and N proteins of avian infectious bronchitis virus.

    ID: 1498086

    Description: epitope description:QAIKAKKLNVPQPKFEG antigen name:Nucleoprotein host organism:Gallus gallus

    Publication: 15868095;

  48. Identification of previously unknown antigenic epitopes on the S and N proteins of avian infectious bronchitis virus.

    ID: 1498087

    Description: epitope description:GYWRRQARYKPGKSG antigen name:Nucleoprotein host organism:Gallus gallus

    Publication: 15868095;

  49. Antigenic analysis of gonococcal pili using monoclonal antibodies.

    ID: 1498104

    Description: epitope description:PPSDIKGK antigen name:UniProt:D1DKT5 host organism:Mus musculus BALB/c antibody name:9B9/H5

    Publication: 6210338;

  50. Localization of antigenic domains on the major subunits of Bordetella pertussis serotype 2 and 3 fimbriae.

    ID: 1498109

    Description: epitope description:G84, D85, L86, I87, A88, Y89, K90, Q91, T92, Y93, T144, N145, G146, S147, K148, S149, Y150, T151, L152, R153 antigen name:Serotyp...

    Publication: 7512870;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston