Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Localisation of linear epitopes at the carboxy-terminal end of the mycobacterial 71 kDa heat shock protein.

    ID: 1270825

    Description: epitope description:SDLRSSSG antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 1379682;

  2. Localisation of linear epitopes at the carboxy-terminal end of the mycobacterial 71 kDa heat shock protein.

    ID: 1270826

    Description: epitope description:DLRSSSGC antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 1379682;

  3. Intranasal immunization with inactivated tick-borne encephalitis virus and the antigenic peptide 89-119 protects mice against intraperitoneal challeng...

    ID: 1270835

    Description: epitope description:GTVCKRDQSDRGWGNHAGLFGKGSIVTCVKA host organism:Mus musculus BALB/c

    Publication: 16545605;

  4. Mapping of the regions on the heavy chain of botulinum neurotoxin A (BoNT/A) recognized by antibodies of cervical dystonia patients with immunoresista...

    ID: 1270888

    Description: epitope description:EVILKNAIVYNSMYENFST antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Homo sapiens antibody name:Mouse prote...

    Publication: 16647121;

  5. Mapping of the regions on the heavy chain of botulinum neurotoxin A (BoNT/A) recognized by antibodies of cervical dystonia patients with immunoresista...

    ID: 1270890

    Description: epitope description:FNSISLNNEYTIINCMENN antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Homo sapiens antibody name:Mouse prote...

    Publication: 16647121;

  6. Mapping of the regions on the heavy chain of botulinum neurotoxin A (BoNT/A) recognized by antibodies of cervical dystonia patients with immunoresista...

    ID: 1270891

    Description: epitope description:CMENNSGWKVSLNYGEIIW antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Homo sapiens antibody name:Mouse prote...

    Publication: 16647121;

  7. Mapping of the regions on the heavy chain of botulinum neurotoxin A (BoNT/A) recognized by antibodies of cervical dystonia patients with immunoresista...

    ID: 1270896

    Description: epitope description:DQKPISNLGNIHASNNIMF antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Homo sapiens antibody name:Mouse prote...

    Publication: 16647121;

  8. Mapping of the regions on the heavy chain of botulinum neurotoxin A (BoNT/A) recognized by antibodies of cervical dystonia patients with immunoresista...

    ID: 1270897

    Description: epitope description:NNIMFKLDGCRDTHRYIWI antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Homo sapiens antibody name:Mouse prote...

    Publication: 16647121;

  9. Mapping of the regions on the heavy chain of botulinum neurotoxin A (BoNT/A) recognized by antibodies of cervical dystonia patients with immunoresista...

    ID: 1270900

    Description: epitope description:NSGILKDFWGDYLQYDKPY antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Homo sapiens antibody name:Mouse prote...

    Publication: 16647121;

  10. Mapping of the regions on the heavy chain of botulinum neurotoxin A (BoNT/A) recognized by antibodies of cervical dystonia patients with immunoresista...

    ID: 1270901

    Description: epitope description:YDKPYYMLNLYDPNKYVDV antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Homo sapiens antibody name:Mouse prote...

    Publication: 16647121;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston