Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "
  1. Characterization of the nucleocapsid protein of Hantaan virus strain 76-118 using monoclonal antibodies.

    ID: 1459184

    Description: epitope description:EDVNGIRKPK antigen name:Hantaan orthohantavirus protein host organism:Mus musculus BALB/c antibody name:MAb E5/G6

    Publication: 8627258;
  2. Characterization of the nucleocapsid protein of Hantaan virus strain 76-118 using monoclonal antibodies.

    ID: 1459189

    Description: epitope description:EDVNGIRKPK antigen name:Hantaan orthohantavirus protein host organism:Mus musculus BALB/c antibody name:MAb E5/G6

    Publication: 8627258;
  3. Characterization of B cell epitopes on the 16K antigen of Mycobacterium tuberculosis.

    ID: 1459481

    Description: epitope description:PRSLFPEFSELFAAFPSFAG antigen name:Alpha-crystallin host organism:Homo sapiens

    Publication: 1381300;
  4. Characterization of B cell epitopes on the 16K antigen of Mycobacterium tuberculosis.

    ID: 1459483

    Description: epitope description:DPDKDVDIMVRDGQLTIKAE antigen name:Alpha-crystallin host organism:Homo sapiens

    Publication: 1381300;
  5. Heterotypic protection induced by synthetic peptides corresponding to three serotypes of foot-and-mouth disease virus.

    ID: 1459492

    Description: epitope description:CCRHKQKIIAPAKQLLPPSGSGRRGDMGSLAARVVKQPCG host organism:Bos taurus antibody name:Cattle sera

    Publication: 2157884;
  6. Implications of antibodies to pyruvylated glucose in healthy populations for mycobacterioses and other infectious diseases.

    ID: 1459524

    Description: epitope description:4,6-(1'-carboxyethylidene)-3-O-methyl-beta-D-glucopyranose antigen name:GPL-8 host organism:Homo sapiens

    Publication: 2332469;
  7. Implications of antibodies to pyruvylated glucose in healthy populations for mycobacterioses and other infectious diseases.

    ID: 1459525

    Description: epitope description:4,6-(1'-carboxyethylidene)-3-O-methyl-beta-D-glucopyranose antigen name:GPL-8 host organism:Homo sapiens

    Publication: 2332469;
  8. Vaccination against gonorrhoea: the potential protective effect of immunization with a synthetic peptide containing a conserved epitope of gonococcal ...

    ID: 1459543

    Description: epitope description:DDQTYSIPSLFV antigen name:Membrane protein (UniProt:Q5F5V7) host organism:Oryctolagus cuniculus

    Publication: 1694611;
  9. Protection against P. aeruginosa with an adenovirus vector containing an OprF epitope in the capsid.

    ID: 1459585

    Description: epitope description:NATAEGRAINRRVE antigen name:Outer membrane porin F host organism:Mus musculus C57BL/6 antibody name:Mouse serum

    Publication: 15841217;
  10. Protection against P. aeruginosa with an adenovirus vector containing an OprF epitope in the capsid.

    ID: 1459587

    Description: epitope description:NATAEGRAINRRVE antigen name:Outer membrane porin F host organism:Mus musculus C57BL/6 antibody name:Mouse serum

    Publication: 15841217;
  11. Heterogeneity of linear B cell epitopes of the measles virus fusion protein reacting with late convalescent sera.

    ID: 1459603

    Description: epitope description:NVSAIFMAVLLTLQT antigen name:Fusion glycoprotein F0 host organism:Homo sapiens antibody name:Human sera

    Publication: 1383402;
  12. Heterogeneity of linear B cell epitopes of the measles virus fusion protein reacting with late convalescent sera.

    ID: 1459608

    Description: epitope description:SKIGVVGIGSASYKV antigen name:Fusion glycoprotein F0 host organism:Homo sapiens antibody name:Human sera

    Publication: 1383402;
  13. Heterogeneity of linear B cell epitopes of the measles virus fusion protein reacting with late convalescent sera.

    ID: 1459609

    Description: epitope description:VGIGSASYKVMTRSS antigen name:Fusion glycoprotein F0 host organism:Homo sapiens antibody name:Human sera

    Publication: 1383402;
  14. Heterogeneity of linear B cell epitopes of the measles virus fusion protein reacting with late convalescent sera.

    ID: 1459622

    Description: epitope description:VQSVASSRRHKRFAG antigen name:Fusion glycoprotein F0 host organism:Homo sapiens antibody name:Human sera

    Publication: 1383402;
  15. Heterogeneity of linear B cell epitopes of the measles virus fusion protein reacting with late convalescent sera.

    ID: 1459624

    Description: epitope description:KRFAGVVLAGAALGV antigen name:Fusion glycoprotein F0 host organism:Homo sapiens antibody name:Human sera

    Publication: 1383402;
  16. Heterogeneity of linear B cell epitopes of the measles virus fusion protein reacting with late convalescent sera.

    ID: 1459634

    Description: epitope description:IEAIRQAGQEMILAV antigen name:Fusion glycoprotein F0 host organism:Homo sapiens antibody name:Human sera

    Publication: 1383402;
  17. Heterogeneity of linear B cell epitopes of the measles virus fusion protein reacting with late convalescent sera.

    ID: 1459635

    Description: epitope description:QAGQEMILAVQGVQD antigen name:Fusion glycoprotein F0 host organism:Homo sapiens antibody name:Human sera

    Publication: 1383402;
  18. Heterogeneity of linear B cell epitopes of the measles virus fusion protein reacting with late convalescent sera.

    ID: 1459639

    Description: epitope description:LIPSMNQLSCDLIGQ antigen name:Fusion glycoprotein F0 host organism:Homo sapiens antibody name:Human sera

    Publication: 1383402;
  19. Heterogeneity of linear B cell epitopes of the measles virus fusion protein reacting with late convalescent sera.

    ID: 1459649

    Description: epitope description:YALGGDINKVLEKLG antigen name:Fusion glycoprotein F0 host organism:Homo sapiens antibody name:Human sera

    Publication: 1383402;
  20. Heterogeneity of linear B cell epitopes of the measles virus fusion protein reacting with late convalescent sera.

    ID: 1459655

    Description: epitope description:KARITHVDTESYFIV antigen name:Fusion glycoprotein F0 host organism:Homo sapiens antibody name:Human sera

    Publication: 1383402;

Displaying 20 of 1,510,353 results for " "