Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270564

    Description: epitope description:WNNKTPNSIA antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  2. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270567

    Description: epitope description:KIDKLCVWNN antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  3. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270573

    Description: epitope description:VWNNKTPNSI antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  4. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270582

    Description: epitope description:TPNSIAAISM antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  5. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270583

    Description: epitope description:PNSIAAISME antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  6. Mapping a neutralizing epitope on the SARS coronavirus spike protein: computational prediction based on affinity-selected peptides.

    ID: 1270683

    Description: epitope description:PMHECLSAPSVCADNY host organism:Homo sapiens antibody name:80R

    Publication: 16630634;

  7. Mapping a neutralizing epitope on the SARS coronavirus spike protein: computational prediction based on affinity-selected peptides.

    ID: 1270685

    Description: epitope description:ETFTCISAPWTCVTWL host organism:Homo sapiens antibody name:80R

    Publication: 16630634;

  8. Mapping a neutralizing epitope on the SARS coronavirus spike protein: computational prediction based on affinity-selected peptides.

    ID: 1270692

    Description: epitope description:TPPRCSDQMYCSLSR host organism:Homo sapiens antibody name:80R

    Publication: 16630634;

  9. Mapping a neutralizing epitope on the SARS coronavirus spike protein: computational prediction based on affinity-selected peptides.

    ID: 1270693

    Description: epitope description:THQFCPDPKHCLAQP host organism:Homo sapiens antibody name:80R

    Publication: 16630634;

  10. Mapping a neutralizing epitope on the SARS coronavirus spike protein: computational prediction based on affinity-selected peptides.

    ID: 1270696

    Description: epitope description:TSNFCPAGGPCSPHG host organism:Homo sapiens antibody name:80R

    Publication: 16630634;

  11. Mapping a neutralizing epitope on the SARS coronavirus spike protein: computational prediction based on affinity-selected peptides.

    ID: 1270709

    Description: epitope description:NNWPCLNETCPTKG host organism:Homo sapiens antibody name:80R

    Publication: 16630634;

  12. Mapping a neutralizing epitope on the SARS coronavirus spike protein: computational prediction based on affinity-selected peptides.

    ID: 1270714

    Description: epitope description:RQTEPCNLWFCPQV host organism:Homo sapiens antibody name:80R

    Publication: 16630634;

  13. Mapping a neutralizing epitope on the SARS coronavirus spike protein: computational prediction based on affinity-selected peptides.

    ID: 1270724

    Description: epitope description:NLSCTHPLGSPPPAP host organism:Homo sapiens antibody name:80R

    Publication: 16630634;

  14. Mapping a neutralizing epitope on the SARS coronavirus spike protein: computational prediction based on affinity-selected peptides.

    ID: 1270727

    Description: epitope description:QTPPCPIEHCPSFYQ host organism:Homo sapiens antibody name:80R

    Publication: 16630634;

  15. Mapping a neutralizing epitope on the SARS coronavirus spike protein: computational prediction based on affinity-selected peptides.

    ID: 1270729

    Description: epitope description:PNCWVGLTGAHSCFL host organism:Homo sapiens antibody name:80R

    Publication: 16630634;

  16. Mapping a neutralizing epitope on the SARS coronavirus spike protein: computational prediction based on affinity-selected peptides.

    ID: 1270730

    Description: epitope description:THSVPVAYPWPDLNA host organism:Homo sapiens antibody name:80R

    Publication: 16630634;

  17. Localisation of linear epitopes at the carboxy-terminal end of the mycobacterial 71 kDa heat shock protein.

    ID: 1270758

    Description: epitope description:HWRCPPRR antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 1379682;

  18. Localisation of linear epitopes at the carboxy-terminal end of the mycobacterial 71 kDa heat shock protein.

    ID: 1270765

    Description: epitope description:RRRAGRCP antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 1379682;

  19. Localisation of linear epitopes at the carboxy-terminal end of the mycobacterial 71 kDa heat shock protein.

    ID: 1270766

    Description: epitope description:RAGRCPPR antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 1379682;

  20. Localisation of linear epitopes at the carboxy-terminal end of the mycobacterial 71 kDa heat shock protein.

    ID: 1270770

    Description: epitope description:QTEKFVKE antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 1379682;

  21. Localisation of linear epitopes at the carboxy-terminal end of the mycobacterial 71 kDa heat shock protein.

    ID: 1270772

    Description: epitope description:EKFVKEQR antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 1379682;

  22. Localisation of linear epitopes at the carboxy-terminal end of the mycobacterial 71 kDa heat shock protein.

    ID: 1270773

    Description: epitope description:KFVKEQRE antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 1379682;

  23. Localisation of linear epitopes at the carboxy-terminal end of the mycobacterial 71 kDa heat shock protein.

    ID: 1270774

    Description: epitope description:FVKEQREA antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 1379682;

  24. Localisation of linear epitopes at the carboxy-terminal end of the mycobacterial 71 kDa heat shock protein.

    ID: 1270777

    Description: epitope description:EQREAEGG antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 1379682;

  25. Localisation of linear epitopes at the carboxy-terminal end of the mycobacterial 71 kDa heat shock protein.

    ID: 1270785

    Description: epitope description:SKVPEDTL antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 1379682;

  26. Localisation of linear epitopes at the carboxy-terminal end of the mycobacterial 71 kDa heat shock protein.

    ID: 1270798

    Description: epitope description:AEAEGGTW antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 1379682;

  27. Localisation of linear epitopes at the carboxy-terminal end of the mycobacterial 71 kDa heat shock protein.

    ID: 1270810

    Description: epitope description:HQVGDGEA antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 1379682;

  28. Localisation of linear epitopes at the carboxy-terminal end of the mycobacterial 71 kDa heat shock protein.

    ID: 1270814

    Description: epitope description:EAGPGVAG antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 1379682;

  29. Localisation of linear epitopes at the carboxy-terminal end of the mycobacterial 71 kDa heat shock protein.

    ID: 1270823

    Description: epitope description:GASDLRSS antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 1379682;

  30. Localisation of linear epitopes at the carboxy-terminal end of the mycobacterial 71 kDa heat shock protein.

    ID: 1270824

    Description: epitope description:ASDLRSSS antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 1379682;

  31. Localisation of linear epitopes at the carboxy-terminal end of the mycobacterial 71 kDa heat shock protein.

    ID: 1270825

    Description: epitope description:SDLRSSSG antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 1379682;

  32. Localisation of linear epitopes at the carboxy-terminal end of the mycobacterial 71 kDa heat shock protein.

    ID: 1270826

    Description: epitope description:DLRSSSGC antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 1379682;

  33. Intranasal immunization with inactivated tick-borne encephalitis virus and the antigenic peptide 89-119 protects mice against intraperitoneal challeng...

    ID: 1270835

    Description: epitope description:GTVCKRDQSDRGWGNHAGLFGKGSIVTCVKA host organism:Mus musculus BALB/c

    Publication: 16545605;

  34. Mapping of the regions on the heavy chain of botulinum neurotoxin A (BoNT/A) recognized by antibodies of cervical dystonia patients with immunoresista...

    ID: 1270888

    Description: epitope description:EVILKNAIVYNSMYENFST antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Homo sapiens antibody name:Mouse prote...

    Publication: 16647121;

  35. Mapping of the regions on the heavy chain of botulinum neurotoxin A (BoNT/A) recognized by antibodies of cervical dystonia patients with immunoresista...

    ID: 1270890

    Description: epitope description:FNSISLNNEYTIINCMENN antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Homo sapiens antibody name:Mouse prote...

    Publication: 16647121;

  36. Mapping of the regions on the heavy chain of botulinum neurotoxin A (BoNT/A) recognized by antibodies of cervical dystonia patients with immunoresista...

    ID: 1270891

    Description: epitope description:CMENNSGWKVSLNYGEIIW antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Homo sapiens antibody name:Mouse prote...

    Publication: 16647121;

  37. Mapping of the regions on the heavy chain of botulinum neurotoxin A (BoNT/A) recognized by antibodies of cervical dystonia patients with immunoresista...

    ID: 1270896

    Description: epitope description:DQKPISNLGNIHASNNIMF antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Homo sapiens antibody name:Mouse prote...

    Publication: 16647121;

  38. Mapping of the regions on the heavy chain of botulinum neurotoxin A (BoNT/A) recognized by antibodies of cervical dystonia patients with immunoresista...

    ID: 1270897

    Description: epitope description:NNIMFKLDGCRDTHRYIWI antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Homo sapiens antibody name:Mouse prote...

    Publication: 16647121;

  39. Mapping of the regions on the heavy chain of botulinum neurotoxin A (BoNT/A) recognized by antibodies of cervical dystonia patients with immunoresista...

    ID: 1270900

    Description: epitope description:NSGILKDFWGDYLQYDKPY antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Homo sapiens antibody name:Mouse prote...

    Publication: 16647121;

  40. Mapping of the regions on the heavy chain of botulinum neurotoxin A (BoNT/A) recognized by antibodies of cervical dystonia patients with immunoresista...

    ID: 1270901

    Description: epitope description:YDKPYYMLNLYDPNKYVDV antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Homo sapiens antibody name:Mouse prote...

    Publication: 16647121;

  41. Mapping of the regions on the heavy chain of botulinum neurotoxin A (BoNT/A) recognized by antibodies of cervical dystonia patients with immunoresista...

    ID: 1270903

    Description: epitope description:YLKGPRGSVMTTNIYLNSS antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Homo sapiens antibody name:Mouse prote...

    Publication: 16647121;

  42. Mapping of the regions on the heavy chain of botulinum neurotoxin A (BoNT/A) recognized by antibodies of cervical dystonia patients with immunoresista...

    ID: 1270904

    Description: epitope description:YLNSSLYRGTKFIIKKYAS antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Homo sapiens antibody name:Mouse prote...

    Publication: 16647121;

  43. Mapping of the regions on the heavy chain of botulinum neurotoxin A (BoNT/A) recognized by antibodies of cervical dystonia patients with immunoresista...

    ID: 1270906

    Description: epitope description:NDRVYINVVVKNKEYRLAT antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Homo sapiens antibody name:Mouse prote...

    Publication: 16647121;

  44. A 27 amino acid coding region of JE virus E protein expressed in E. coli as fusion protein with glutathione-S-transferase elicit neutralizing antibody...

    ID: 1270914

    Description: epitope description:EAHNEKRADSSYVCKQGFTDRGWGNGC antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 8822638;

  45. Genotype 1 and genotype 2 bovine noroviruses are antigenically distinct but share a cross-reactive epitope with human noroviruses.

    ID: 1271051

    Description: epitope description:PTAGAQIAA antigen name:Capsid protein VP1 host organism:Mus musculus BALB/c antibody name:CM39

    Publication: 16517888;

  46. Genotype 1 and genotype 2 bovine noroviruses are antigenically distinct but share a cross-reactive epitope with human noroviruses.

    ID: 1271055

    Description: epitope description:PTAGAQIAA antigen name:Capsid protein VP1 host organism:Mus musculus BALB/c antibody name:CM39

    Publication: 16517888;

  47. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1271057

    Description: epitope description:GKREMVIITF antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus C57BL/10

    Publication: 8606092;

  48. Genotype 1 and genotype 2 bovine noroviruses are antigenically distinct but share a cross-reactive epitope with human noroviruses.

    ID: 1271061

    Description: epitope description:PTAGAQIAA antigen name:Capsid protein VP1 host organism:Mus musculus BALB/c antibody name:CM39

    Publication: 16517888;

  49. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1271064

    Description: epitope description:EMVIITFKSG antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus C57BL/10

    Publication: 8606092;

  50. Template-based coiled-coil antigens elicit neutralizing antibodies to the SARS-coronavirus.

    ID: 1271071

    Description: epitope description:N1155, A1156, S1157, V1159, N1160, Q1162, K1163, E1164, D1166, R1167, N1169, E1170, V1171, K1173, N1174, N1176, E1177, S1178 antig...

    Publication: 16697221;

  51. Epitope mapping of the Sta58 major outer membrane protein of Rickettsia tsutsugamushi.

    ID: 1271083

    Description: epitope description:VNSRCEQI antigen name:60 kDa chaperonin host organism:Homo sapiens

    Publication: 7691753;

  52. Epitope mapping of the Sta58 major outer membrane protein of Rickettsia tsutsugamushi.

    ID: 1271085

    Description: epitope description:ARTMQYVD antigen name:60 kDa chaperonin host organism:Homo sapiens

    Publication: 7691753;

  53. Anti-cord factor (trehalose 6,6'dimycolate) IgG antibody in tuberculosis patients recognizes mycolic acid subclasses.

    ID: 1271136

    Description: epitope description:alpha-mycolic acid antigen name:alpha,alpha'-trehalose 6,6'-bismycolate host organism:Homo sapiens

    Publication: 10553679;

  54. A dominant linear B-cell epitope of ricin A-chain is the target of a neutralizing antibody response in Hodgkin's lymphoma patients treated with an ant...

    ID: 1271139

    Description: epitope description:RSFIICIQMISEAAR antigen name:rRNA N-glycosidase (UniProt:B9T8T0) host organism:Homo sapiens antibody name:HARA

    Publication: 15086403;

  55. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271149

    Description: epitope description:SDIKTTTSSHPVSSLT antigen name:Invasin IpaD host organism:Mus musculus BALB/cByJ antibody name:16F8

    Publication: 9573082;

  56. Anti-cord factor (trehalose 6,6'dimycolate) IgG antibody in tuberculosis patients recognizes mycolic acid subclasses.

    ID: 1271153

    Description: epitope description:keto mycolic acid antigen name:alpha,alpha'-trehalose 6,6'-bismycolate host organism:Homo sapiens

    Publication: 10553679;

  57. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271161

    Description: epitope description:LKEKYKDK antigen name:Invasin IpaD host organism:Oryctolagus cuniculus

    Publication: 9573082;

  58. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271165

    Description: epitope description:DVNKSAQL antigen name:Invasin IpaD host organism:Oryctolagus cuniculus

    Publication: 9573082;

  59. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271178

    Description: epitope description:GSSTETVN antigen name:Invasin IpaD host organism:Oryctolagus cuniculus

    Publication: 9573082;

  60. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271182

    Description: epitope description:VSINMTPIDN antigen name:Invasin IpaD host organism:Oryctolagus cuniculus

    Publication: 9573082;

  61. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271184

    Description: epitope description:LDNLGGNG antigen name:Invasin IpaD host organism:Oryctolagus cuniculus

    Publication: 9573082;

  62. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1271188

    Description: epitope description:SYTESMAGKR antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  63. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1271196

    Description: epitope description:YTESMAGKRE antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  64. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1271204

    Description: epitope description:ESMAGKREMV antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  65. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1271205

    Description: epitope description:ESMAGKREMV antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  66. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1271216

    Description: epitope description:MAGKREMVII antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  67. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1271217

    Description: epitope description:AGKREMVIIT antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  68. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1271223

    Description: epitope description:GKREMVIITF antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  69. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1271224

    Description: epitope description:GKREMVIITF antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  70. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1271232

    Description: epitope description:REMVIITFKS antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  71. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1271233

    Description: epitope description:EMVIITFKSG antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  72. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1271234

    Description: epitope description:EMVIITFKSG antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  73. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1271244

    Description: epitope description:VIITFKSGAT antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  74. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1271245

    Description: epitope description:IITFKSGATF antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  75. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1271252

    Description: epitope description:ITFKSGATFQ antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  76. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1271253

    Description: epitope description:TFKSGATFQV antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  77. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1271257

    Description: epitope description:FKSGATFQVE antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  78. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1271259

    Description: epitope description:FKSGATFQVE antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  79. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1271260

    Description: epitope description:FKSGATFQVE antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  80. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1271265

    Description: epitope description:SGATFQVEVP antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  81. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274051

    Description: epitope description:VAVLKVGGTSDVE antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  82. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274060

    Description: epitope description:AMTIAKNAGVEGS antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  83. Mapping of the antibody-binding regions on botulinum neurotoxin H-chain domain 855-1296 with antitoxin antibodies from three host species.

    ID: 1273779

    Description: epitope description:RYIWIKYFNLFDKELNEKE antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Equus caballus

    Publication: 8968960;

  84. Mapping of the antibody-binding regions on botulinum neurotoxin H-chain domain 855-1296 with antitoxin antibodies from three host species.

    ID: 1273783

    Description: epitope description:NSGILKDFWGDYLQYDKPY antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus

    Publication: 8968960;

  85. Mapping of the antibody-binding regions on botulinum neurotoxin H-chain domain 855-1296 with antitoxin antibodies from three host species.

    ID: 1273792

    Description: epitope description:YLKGPRGSVMTTNIYLNSS antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Homo sapiens

    Publication: 8968960;

  86. Mapping of the antibody-binding regions on botulinum neurotoxin H-chain domain 855-1296 with antitoxin antibodies from three host species.

    ID: 1273795

    Description: epitope description:YLNSSLYRGTKFIIKKYAS antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Homo sapiens

    Publication: 8968960;

  87. Mapping of the antibody-binding regions on botulinum neurotoxin H-chain domain 855-1296 with antitoxin antibodies from three host species.

    ID: 1273802

    Description: epitope description:NDRVYINVVVKNKEYRLAT antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Equus caballus

    Publication: 8968960;

  88. Mapping of the antibody-binding regions on botulinum neurotoxin H-chain domain 855-1296 with antitoxin antibodies from three host species.

    ID: 1273807

    Description: epitope description:ILSALEIPDVGNLSQVVVM antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Equus caballus

    Publication: 8968960;

  89. Mapping of the antibody-binding regions on botulinum neurotoxin H-chain domain 855-1296 with antitoxin antibodies from three host species.

    ID: 1273810

    Description: epitope description:QVVVMKSKNDQGITNKCKM antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus

    Publication: 8968960;

  90. Mapping of the antibody-binding regions on botulinum neurotoxin H-chain domain 855-1296 with antitoxin antibodies from three host species.

    ID: 1273816

    Description: epitope description:IGFIGFHQFNNIAKLVASN antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Homo sapiens

    Publication: 8968960;

  91. Mapping of the antibody-binding regions on botulinum neurotoxin H-chain domain 855-1296 with antitoxin antibodies from three host species.

    ID: 1273818

    Description: epitope description:IGFIGFHQFNNIAKLVASN antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus

    Publication: 8968960;

  92. Mapping of the antibody-binding regions on botulinum neurotoxin H-chain domain 855-1296 with antitoxin antibodies from three host species.

    ID: 1273819

    Description: epitope description:LVASNWYNRQIERSSRTLG antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Homo sapiens

    Publication: 8968960;

  93. Mapping of the antibody-binding regions on botulinum neurotoxin H-chain domain 855-1296 with antitoxin antibodies from three host species.

    ID: 1273820

    Description: epitope description:LVASNWYNRQIERSSRTLG antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus

    Publication: 8968960;

  94. Mapping of the antibody-binding regions on botulinum neurotoxin H-chain domain 855-1296 with antitoxin antibodies from three host species.

    ID: 1273821

    Description: epitope description:LVASNWYNRQIERSSRTLG antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Equus caballus

    Publication: 8968960;

  95. Identification and assessment of new vaccine candidates for group A streptococcal infections.

    ID: 1273846

    Description: epitope description:AQNFRNIMHGSDSFFYTFTS antigen name:UniProt:A2RH27 host organism:Mus musculus Quackenbush

    Publication: 15246612;

  96. Identification and assessment of new vaccine candidates for group A streptococcal infections.

    ID: 1273850

    Description: epitope description:ESVLQAQMAAQQLPVIGGIA antigen name:UniProt:A2REG7 host organism:Mus musculus Quackenbush

    Publication: 15246612;

  97. Identification and assessment of new vaccine candidates for group A streptococcal infections.

    ID: 1273853

    Description: epitope description:QEVFSLVKEPILKQTQASSS antigen name:UniProt:A2RF53 host organism:Mus musculus Quackenbush

    Publication: 15246612;

  98. Identification and assessment of new vaccine candidates for group A streptococcal infections.

    ID: 1273854

    Description: epitope description:QEVFSLVKEPILKQTQASSS antigen name:UniProt:A2RF53 host organism:Mus musculus Quackenbush

    Publication: 15246612;

  99. Identification and assessment of new vaccine candidates for group A streptococcal infections.

    ID: 1273864

    Description: epitope description:EKLALRNEERAIDELKKQAIEDKE antigen name:UniProt:A2RE08 host organism:Mus musculus Quackenbush

    Publication: 15246612;

  100. Identification and assessment of new vaccine candidates for group A streptococcal infections.

    ID: 1273872

    Description: epitope description:KQLIAKDPKNKETYEKN antigen name:UniProt:A2RG39 host organism:Mus musculus Quackenbush

    Publication: 15246612;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston