Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Localization of antigenic domains on the major subunits of Bordetella pertussis serotype 2 and 3 fimbriae.

    ID: 1498111

    Description: epitope description:GDLRAYKMVYATNPQTQLSN antigen name:Serotype 2 fimbrial subunit host organism:Mus musculus Porton

    Publication: 7512870;

  2. Localization of antigenic domains on the major subunits of Bordetella pertussis serotype 2 and 3 fimbriae.

    ID: 1498118

    Description: epitope description:QALGALKLYFEPGITTNYDTGDLIAYKQTYNASGN antigen name:Serotype 3 fimbrial subunit host organism:Mus musculus Porton

    Publication: 7512870;

  3. A 10-amino-acid linear sequence of VP1 of foot and mouth disease virus containing B- and T-cell epitopes induces protection in mice.

    ID: 1498137

    Description: epitope description:RGDLQVLAQK antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 7571431;

  4. The major outer membrane protein of a single Chlamydia trachomatis serovar can possess more than one serovar-specific epitope.

    ID: 1498140

    Description: epitope description:NQSTVK antigen name:Major outer membrane porin, serovar D host organism:Mus musculus BALB/c antibody name:EL11

    Publication: 8550205;

  5. Mapping of linear epitopes of the regulatory proteins of human T cell lymphotropic virus (HTLV) type II: identification of an HTLV-IIb-restricted epit...

    ID: 1498144

    Description: epitope description:SYMDTPSTCLAIVYRPIGVP antigen name:Protein Rex host organism:Homo sapiens

    Publication: 7622904;

  6. A 10-amino-acid linear sequence of VP1 of foot and mouth disease virus containing B- and T-cell epitopes induces protection in mice.

    ID: 1498153

    Description: epitope description:RYSRNAVPNV antigen name:Polyprotein host organism:Mus musculus BALB/c

    Publication: 7571431;

  7. A 10-amino-acid linear sequence of VP1 of foot and mouth disease virus containing B- and T-cell epitopes induces protection in mice.

    ID: 1498155

    Description: epitope description:VLAQKVARTLP antigen name:Polyprotein host organism:Mus musculus BALB/c

    Publication: 7571431;

  8. Mapping of linear epitopes of the regulatory proteins of human T cell lymphotropic virus (HTLV) type II: identification of an HTLV-IIb-restricted epit...

    ID: 1498165

    Description: epitope description:GRVVSSPLQYLIPRLPSFPT antigen name:Protein Tax-2 host organism:Homo sapiens

    Publication: 7622904;

  9. Mapping of linear epitopes of the regulatory proteins of human T cell lymphotropic virus (HTLV) type II: identification of an HTLV-IIb-restricted epit...

    ID: 1498172

    Description: epitope description:DDLPTTMFQPVRAPCIQTAW antigen name:Protein Tax-2 host organism:Homo sapiens

    Publication: 7622904;

  10. Mapping of linear epitopes of the regulatory proteins of human T cell lymphotropic virus (HTLV) type II: identification of an HTLV-IIb-restricted epit...

    ID: 1498173

    Description: epitope description:IQTAWCTGLLPYHSILTTPG antigen name:Protein Tax-2 host organism:Homo sapiens

    Publication: 7622904;

  11. Mapping of linear epitopes of the regulatory proteins of human T cell lymphotropic virus (HTLV) type II: identification of an HTLV-IIb-restricted epit...

    ID: 1498177

    Description: epitope description:DDNGDRPPEPAAQGESSTQK antigen name:Protein Tax-2 host organism:Homo sapiens

    Publication: 7622904;

  12. A 10-amino-acid linear sequence of VP1 of foot and mouth disease virus containing B- and T-cell epitopes induces protection in mice.

    ID: 1498181

    Description: epitope description:AVPNVRGDLQ antigen name:Polyprotein host organism:Mus musculus BALB/c

    Publication: 7571431;

  13. A 10-amino-acid linear sequence of VP1 of foot and mouth disease virus containing B- and T-cell epitopes induces protection in mice.

    ID: 1498184

    Description: epitope description:VLAQKVARTLP antigen name:Polyprotein host organism:Mus musculus BALB/c

    Publication: 7571431;

  14. Definition of a conserved immunodominant domain on hepatitis C virus E2 glycoprotein by neutralizing human monoclonal antibodies.

    ID: 1498187

    Description: epitope description:W529, G530, D535 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:HC-1

    Publication: 18400849;

  15. Definition of a conserved immunodominant domain on hepatitis C virus E2 glycoprotein by neutralizing human monoclonal antibodies.

    ID: 1498189

    Description: epitope description:W529, G530, D535 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:HC-1

    Publication: 18400849;

  16. Peptide vaccine against canine parvovirus: identification of two neutralization subsites in the N terminus of VP2 and optimization of the amino acid s...

    ID: 1498235

    Description: epitope description:GGQPAVRNER antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7474152;

  17. Peptide vaccine against canine parvovirus: identification of two neutralization subsites in the N terminus of VP2 and optimization of the amino acid s...

    ID: 1498236

    Description: epitope description:GGQPAVRNER antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7474152;

  18. Peptide vaccine against canine parvovirus: identification of two neutralization subsites in the N terminus of VP2 and optimization of the amino acid s...

    ID: 1498237

    Description: epitope description:GGQPAVRNER antigen name:Capsid protein VP1 host organism:Mus musculus BALB/c

    Publication: 7474152;

  19. Identification of previously unknown antigenic epitopes on the S and N proteins of avian infectious bronchitis virus.

    ID: 1498263

    Description: epitope description:QYNTGNFSDGLYPFTN antigen name:Spike glycoprotein host organism:Gallus gallus

    Publication: 15868095;

  20. Identification of previously unknown antigenic epitopes on the S and N proteins of avian infectious bronchitis virus.

    ID: 1498264

    Description: epitope description:QYNTGNFSDGLYPFTN antigen name:Spike glycoprotein host organism:Gallus gallus

    Publication: 15868095;

  21. Identification of previously unknown antigenic epitopes on the S and N proteins of avian infectious bronchitis virus.

    ID: 1498268

    Description: epitope description:PPNSGGVNTIQLYQTKTAQ antigen name:Spike glycoprotein host organism:Gallus gallus

    Publication: 15868095;

  22. Identification of previously unknown antigenic epitopes on the S and N proteins of avian infectious bronchitis virus.

    ID: 1498270

    Description: epitope description:SGGKLVGILTSRNET antigen name:Spike glycoprotein host organism:Gallus gallus

    Publication: 15868095;

  23. Identification of previously unknown antigenic epitopes on the S and N proteins of avian infectious bronchitis virus.

    ID: 1498271

    Description: epitope description:SGGKLVGILTSRNET antigen name:Spike glycoprotein host organism:Gallus gallus

    Publication: 15868095;

  24. Identification of previously unknown antigenic epitopes on the S and N proteins of avian infectious bronchitis virus.

    ID: 1498276

    Description: epitope description:NCPYVSYGKFCIKPDGSIST antigen name:Spike glycoprotein host organism:Gallus gallus

    Publication: 15868095;

  25. Identification of previously unknown antigenic epitopes on the S and N proteins of avian infectious bronchitis virus.

    ID: 1498278

    Description: epitope description:QAIKAKKLNVPQPKFEG antigen name:Nucleoprotein host organism:Gallus gallus

    Publication: 15868095;

  26. DNA vaccines expressing B and T cell epitopes can protect mice from FMDV infection in the absence of specific humoral responses.

    ID: 1498339

    Description: epitope description:TTTYTASARGDLAHLTTTHARHLP antigen name:Polyprotein host organism:Mus musculus antibody name:SD6

    Publication: 16563575;

  27. DNA vaccines expressing B and T cell epitopes can protect mice from FMDV infection in the absence of specific humoral responses.

    ID: 1498340

    Description: epitope description:TTTYTASARGDLAHLTTTHARHLP antigen name:Polyprotein host organism:Mus musculus Swiss

    Publication: 16563575;

  28. Phage-displayed mimotopes elicit monoclonal antibodies specific for a malaria vaccine candidate.

    ID: 1498382

    Description: epitope description:CGRVCLRC host organism:Mus musculus antibody name:D14-3

    Publication: 9504719;

  29. DNA vaccines expressing B and T cell epitopes can protect mice from FMDV infection in the absence of specific humoral responses.

    ID: 1498386

    Description: epitope description:TTTYTASARGDLAHLTTTHARHLP antigen name:Polyprotein host organism:Mus musculus Swiss

    Publication: 16563575;

  30. Phage-displayed mimotopes elicit monoclonal antibodies specific for a malaria vaccine candidate.

    ID: 1498389

    Description: epitope description:CGRVCLRC host organism:Mus musculus Biozzi antibody name:F11-2

    Publication: 9504719;

  31. The major outer membrane protein of a single Chlamydia trachomatis serovar can possess more than one serovar-specific epitope.

    ID: 1498611

    Description: epitope description:DVKTGAE antigen name:Major outer membrane porin, serovar D host organism:Mus musculus BALB/c antibody name:D1/E9, 113D5, JG-9

    Publication: 8550205;

  32. Inhibition of the myotoxic activity of Bothrops asper myotoxin II in mice by immunization with its synthetic 13-mer peptide 115-129.

    ID: 1498620

    Description: epitope description:KKYRYYLKPLCKK antigen name:Basic phospholipase A2 homolog 2 host organism:Mus musculus Swiss

    Publication: 10082167;

  33. Inhibition of the myotoxic activity of Bothrops asper myotoxin II in mice by immunization with its synthetic 13-mer peptide 115-129.

    ID: 1498622

    Description: epitope description:KKYRYYLKPLCKK antigen name:Basic phospholipase A2 homolog 2 host organism:Mus musculus Swiss

    Publication: 10082167;

  34. Mapping and structural analysis of B-cell epitopes on the morbillivirus nucleoprotein amino terminus.

    ID: 1498682

    Description: epitope description:SRGTSMDDEADR antigen name:Nucleoprotein host organism:Capra hircus antibody name:Immune sera

    Publication: 17374767;

  35. Mapping and structural analysis of B-cell epitopes on the morbillivirus nucleoprotein amino terminus.

    ID: 1498687

    Description: epitope description:GTSMDDEADRYF antigen name:Nucleoprotein host organism:Bos taurus antibody name:Convalescent sera

    Publication: 17374767;

  36. Lipid transfer proteins from Rosaceae fruits share consensus epitopes responsible for their IgE-binding cross-reactivity.

    ID: 1493804

    Description: epitope description:GIRTINGLARTTADR antigen name:Other Malus domestica (apple tree) protein host organism:Oryctolagus cuniculus

    Publication: 18036340;

  37. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1493810

    Description: epitope description:ELADALLE antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;

  38. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1493811

    Description: epitope description:ELADALLE antigen name:UniProt:H6MQD5 host organism:Homo sapiens

    Publication: 8698467;

  39. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1493817

    Description: epitope description:QSFRRLGA antigen name:UniProt:H6MQD5 host organism:Homo sapiens

    Publication: 8698467;

  40. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1493818

    Description: epitope description:VLLGACSF antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;

  41. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1493825

    Description: epitope description:GPEKAFRE antigen name:UniProt:H6MQD5 host organism:Homo sapiens

    Publication: 8698467;

  42. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1493826

    Description: epitope description:AFRELADA antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;

  43. Lipid transfer proteins from Rosaceae fruits share consensus epitopes responsible for their IgE-binding cross-reactivity.

    ID: 1493832

    Description: epitope description:GLARTTADRQTACNC antigen name:Other Malus domestica (apple tree) protein host organism:Oryctolagus cuniculus

    Publication: 18036340;

  44. Lipid transfer proteins from Rosaceae fruits share consensus epitopes responsible for their IgE-binding cross-reactivity.

    ID: 1493836

    Description: epitope description:ADRQTACNCLKNLAG antigen name:Other Malus domestica (apple tree) protein host organism:Oryctolagus cuniculus

    Publication: 18036340;

  45. Lipid transfer proteins from Rosaceae fruits share consensus epitopes responsible for their IgE-binding cross-reactivity.

    ID: 1493846

    Description: epitope description:SISGVNPNNAAGLPG antigen name:Other Malus domestica (apple tree) protein host organism:Oryctolagus cuniculus

    Publication: 18036340;

  46. Lipid transfer proteins from Rosaceae fruits share consensus epitopes responsible for their IgE-binding cross-reactivity.

    ID: 1493848

    Description: epitope description:GVNPNNAAGLPGKCG antigen name:Other Malus domestica (apple tree) protein host organism:Oryctolagus cuniculus

    Publication: 18036340;

  47. Lipid transfer proteins from Rosaceae fruits share consensus epitopes responsible for their IgE-binding cross-reactivity.

    ID: 1493870

    Description: epitope description:HIPYKISASTNCATVK antigen name:Non-specific lipid-transfer protein host organism:Oryctolagus cuniculus

    Publication: 18036340;

  48. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1493886

    Description: epitope description:NGTYRATY antigen name:UniProt:H6MQD5 host organism:Homo sapiens

    Publication: 8698467;

  49. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1493889

    Description: epitope description:GGKMVQVV antigen name:UniProt:H6MQD5 host organism:Homo sapiens

    Publication: 8698467;

  50. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1493894

    Description: epitope description:DYHRVMY antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston