Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Identification and assessment of new vaccine candidates for group A streptococcal infections.

    ID: 1273879

    Description: epitope description:KKTKDTKPVVKKEERQNVN antigen name:UniProt:A2RE08 host organism:Mus musculus Quackenbush

    Publication: 15246612;

  2. Identification and assessment of new vaccine candidates for group A streptococcal infections.

    ID: 1273883

    Description: epitope description:ESSVDRRPMETVSKDS antigen name:UniProt:A2RG39 host organism:Mus musculus Quackenbush

    Publication: 15246612;

  3. Proteinase K enhanced immunoreactivity of the prion protein-specific monoclonal antibody 2A11.

    ID: 1273994

    Description: epitope description:QVYYRPVDQ antigen name:Major prion protein host organism:Mus musculus 129/Ola Prp null antibody name:MAb 2A11

    Publication: 14687883;

  4. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274013

    Description: epitope description:LQGVDLLADAVAV antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  5. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274019

    Description: epitope description:NEEAGDGTTTATV antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  6. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274021

    Description: epitope description:LAVDAVIAELKKQ antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  7. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274027

    Description: epitope description:VKDGKTLNDELEI antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  8. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274028

    Description: epitope description:TLNDELEIIEGMK antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  9. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274029

    Description: epitope description:LEIIEGMKFDRGY antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  10. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274030

    Description: epitope description:GMKFDRGYISPYF antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  11. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274031

    Description: epitope description:RGYISPYFINTSK antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  12. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274034

    Description: epitope description:KCEFQDAYVLLSE antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  13. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274038

    Description: epitope description:EDVDGEALSTLVL antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  14. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274039

    Description: epitope description:NQLKDMAIATGGA antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  15. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274043

    Description: epitope description:TLNLEDVQPHDLG antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  16. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274044

    Description: epitope description:DVQPHDLGKVGEV antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  17. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274046

    Description: epitope description:GEVIVTKDDAMLL antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  18. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274047

    Description: epitope description:QIEKRIQEIIEQL antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  19. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274065

    Description: epitope description:KFGADARALMLQG antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  20. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274071

    Description: epitope description:AKSIDLKDKYKNI antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  21. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274074

    Description: epitope description:DGTTTATVLARSI antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  22. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274082

    Description: epitope description:ISDAMKKVGRKGV antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  23. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274090

    Description: epitope description:LVLNRLKVGLQVV antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  24. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274091

    Description: epitope description:LKVGLQVVAVKAP antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  25. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274099

    Description: epitope description:NERLAKLSDGVAV antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  26. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274103

    Description: epitope description:IVLGGGCALLRCI antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  27. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274106

    Description: epitope description:TLKIPAMTIAKNA antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  28. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274111

    Description: epitope description:PTKVVRTALLDAA antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  29. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274117

    Description: epitope description:KEEKDPGMGAMGG antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  30. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274125

    Description: epitope description:TVFRQMRPVSRVL antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  31. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274128

    Description: epitope description:HLTRAYAKDVKFG antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  32. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274139

    Description: epitope description:AKSIDLKDKYKNI antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  33. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274143

    Description: epitope description:DGTTTATVLARSI antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  34. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274155

    Description: epitope description:VKDGKTLNDELEI antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  35. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274156

    Description: epitope description:TLNDELEIIEGMK antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  36. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274157

    Description: epitope description:LEIIEGMKFDRGY antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  37. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274162

    Description: epitope description:SIVPALEIANAHR antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  38. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274164

    Description: epitope description:LVIIAEDVDGEAL antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  39. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274168

    Description: epitope description:NQLKDMAIATGGA antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  40. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274170

    Description: epitope description:GGAVFGEEGLTLN antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  41. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274175

    Description: epitope description:GEVIVTKDDAMLL antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  42. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274183

    Description: epitope description:NERLAKLSDGVAV antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  43. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274187

    Description: epitope description:DVEVNEKKDRVTD antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  44. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274189

    Description: epitope description:VTDALNATRAAVE antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  45. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274190

    Description: epitope description:NATRAAVEEGIVL antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  46. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274194

    Description: epitope description:PANEDQKIGIEII antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  47. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274197

    Description: epitope description:KNAGVEGSLIVEK antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  48. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274200

    Description: epitope description:QSSSEVGYDAMAG antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  49. Comparison of serologic assays and PCR for diagnosis of human herpesvirus 8 infection.

    ID: 1274202

    Description: epitope description:RSHLGFWQEGWSGQVYQDWLGRMNCSYENMT antigen name:Protein K8.1 host organism:Homo sapiens

    Publication: 10834972;

  50. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274208

    Description: epitope description:RTALLDAAGVASL antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  51. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274215

    Description: epitope description:MGGMGGGMGGGMF antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  52. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274218

    Description: epitope description:KNIGAKLVQDVAN antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  53. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274223

    Description: epitope description:PVTTPEEIAQVAT antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  54. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274232

    Description: epitope description:LVLNRLKVGLQVV antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  55. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274248

    Description: epitope description:LQGVDLLADAVAV antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  56. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274249

    Description: epitope description:LLADAVAVTMGPK antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  57. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274251

    Description: epitope description:TVIIEQSWGSPKV antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  58. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274252

    Description: epitope description:QSWGSPKVTKDGV antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  59. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274268

    Description: epitope description:VKDGKTLNDELEI antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  60. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274274

    Description: epitope description:TSKGQKCEFQDAY antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  61. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274278

    Description: epitope description:EDVDGEALSTLVL antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  62. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274280

    Description: epitope description:LKVGLQVVAVKAP antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  63. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274286

    Description: epitope description:GGAVFGEEGLTLN antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  64. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274297

    Description: epitope description:VTDALNATRAAVE antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  65. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274299

    Description: epitope description:RCIPALDSLTPAN antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  66. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274301

    Description: epitope description:PANEDQKIGIEII antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  67. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274313

    Description: epitope description:TAEVVVTEIPKEE antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  68. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274320

    Description: epitope description:LKDKYKNIGAKLV antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  69. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274322

    Description: epitope description:ATVLARSIAKEGF antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  70. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274325

    Description: epitope description:RRGVMLAVDAVIA antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  71. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274329

    Description: epitope description:KGVITVKDGKTLN antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  72. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274341

    Description: epitope description:NERLAKLSDGVAV antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  73. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1271266

    Description: epitope description:SGATFQVEVP antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  74. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1271271

    Description: epitope description:GATFQVEVPG antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  75. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271274

    Description: epitope description:ITTLTNSI antigen name:Invasin IpaD host organism:Macaca mulatta

    Publication: 9573082;

  76. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271279

    Description: epitope description:NSISTSSF antigen name:Invasin IpaD host organism:Macaca mulatta

    Publication: 9573082;

  77. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271280

    Description: epitope description:SISTSSFS antigen name:Invasin IpaD host organism:Macaca mulatta

    Publication: 9573082;

  78. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271281

    Description: epitope description:ISTSSFSP antigen name:Invasin IpaD host organism:Macaca mulatta

    Publication: 9573082;

  79. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271287

    Description: epitope description:SPNNTNGS antigen name:Invasin IpaD host organism:Macaca mulatta

    Publication: 9573082;

  80. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271307

    Description: epitope description:TSSHPVSS antigen name:Invasin IpaD host organism:Macaca mulatta

    Publication: 9573082;

  81. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271315

    Description: epitope description:LTMLNDTL antigen name:Invasin IpaD host organism:Macaca mulatta

    Publication: 9573082;

  82. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271318

    Description: epitope description:LNDTLHNI antigen name:Invasin IpaD host organism:Macaca mulatta

    Publication: 9573082;

  83. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271323

    Description: epitope description:HNIRTTNQ antigen name:Invasin IpaD host organism:Macaca mulatta

    Publication: 9573082;

  84. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271346

    Description: epitope description:KKELSQKT antigen name:Invasin IpaD host organism:Macaca mulatta

    Publication: 9573082;

  85. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271350

    Description: epitope description:SQKTLTKT antigen name:Invasin IpaD host organism:Macaca mulatta

    Publication: 9573082;

  86. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271351

    Description: epitope description:QKTLTKTS antigen name:Invasin IpaD host organism:Macaca mulatta

    Publication: 9573082;

  87. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271354

    Description: epitope description:LTKTSLEE antigen name:Invasin IpaD host organism:Macaca mulatta

    Publication: 9573082;

  88. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271366

    Description: epitope description:SSQISMDV antigen name:Invasin IpaD host organism:Macaca mulatta

    Publication: 9573082;

  89. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271372

    Description: epitope description:DVNKSAQL antigen name:Invasin IpaD host organism:Macaca mulatta

    Publication: 9573082;

  90. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271383

    Description: epitope description:LSRNEYPI antigen name:Invasin IpaD host organism:Macaca mulatta

    Publication: 9573082;

  91. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271384

    Description: epitope description:SRNEYPIN antigen name:Invasin IpaD host organism:Macaca mulatta

    Publication: 9573082;

  92. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271387

    Description: epitope description:EYPINKDA antigen name:Invasin IpaD host organism:Macaca mulatta

    Publication: 9573082;

  93. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271400

    Description: epitope description:RELLHSAP antigen name:Invasin IpaD host organism:Macaca mulatta

    Publication: 9573082;

  94. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271403

    Description: epitope description:LHSAPKEA antigen name:Invasin IpaD host organism:Macaca mulatta

    Publication: 9573082;

  95. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271404

    Description: epitope description:HSAPKEAE antigen name:Invasin IpaD host organism:Macaca mulatta

    Publication: 9573082;

  96. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271405

    Description: epitope description:SAPKEAEL antigen name:Invasin IpaD host organism:Macaca mulatta

    Publication: 9573082;

  97. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271408

    Description: epitope description:KEAELDGD antigen name:Invasin IpaD host organism:Macaca mulatta

    Publication: 9573082;

  98. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271409

    Description: epitope description:EAELDGDQ antigen name:Invasin IpaD host organism:Macaca mulatta

    Publication: 9573082;

  99. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271412

    Description: epitope description:DGDQMISH antigen name:Invasin IpaD host organism:Macaca mulatta

    Publication: 9573082;

  100. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271414

    Description: epitope description:DQMISHRE antigen name:Invasin IpaD host organism:Macaca mulatta

    Publication: 9573082;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston