Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1493898

    Description: epitope description:YASSGIGP antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;

  2. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1493904

    Description: epitope description:RVMYASSG antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;

  3. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1493906

    Description: epitope description:KMVQVVYD antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;

  4. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1493909

    Description: epitope description:TGATVSSQ antigen name:UniProt:H6MQD5 host organism:Homo sapiens

    Publication: 8698467;

  5. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1493912

    Description: epitope description:FRELADAL antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;

  6. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1493913

    Description: epitope description:FRELADAL antigen name:UniProt:H6MQD5 host organism:Homo sapiens

    Publication: 8698467;

  7. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1493915

    Description: epitope description:EKAFREL antigen name:UniProt:H6MQD5 host organism:Homo sapiens

    Publication: 8698467;

  8. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1493920

    Description: epitope description:VMYASSG antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;

  9. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1493925

    Description: epitope description:YHRVMYAS antigen name:UniProt:H6MQD5 host organism:Homo sapiens

    Publication: 8698467;

  10. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1493926

    Description: epitope description:ADYHRVMY antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;

  11. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1493932

    Description: epitope description:VQVVYDYQ antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;

  12. Generation of rubella virus-neutralising antibodies by vaccination with synthetic peptides.

    ID: 1493935

    Description: epitope description:HGPDWASP antigen name:Structural polyprotein host organism:Mus musculus BALB/c

    Publication: 7539669;

  13. Generation of rubella virus-neutralising antibodies by vaccination with synthetic peptides.

    ID: 1493937

    Description: epitope description:AHTTSDPWHPPG antigen name:Structural polyprotein host organism:Mus musculus BALB/c

    Publication: 7539669;

  14. Immunogenicity of genetically engineered glutathione S-transferase fusion proteins containing a T-cell epitope from diphtheria toxin.

    ID: 1493961

    Description: epitope description:NLFQVVHWSYNRPAYSPG antigen name:Diphtheria toxin (UniProt:Q6NK15) host organism:Oryctolagus cuniculus

    Publication: 7534277;

  15. A monoclonal antibody that recognizes a potential coeliac-toxic repetitive pentapeptide epitope in gliadins.

    ID: 1493965

    Description: epitope description:QQPFP antigen name:Secale cereale (rye) protein host organism:Mus musculus antibody name:R5

    Publication: 11711775;

  16. Mimotopes identify conformational B-cell epitopes on the two major house dust mite allergens Der p 1 and Der p 2.

    ID: 1493974

    Description: epitope description:DMFQIGKYG host organism:Homo sapiens antibody name:anti-Der p 1

    Publication: 17964653;

  17. Mimotopes identify conformational B-cell epitopes on the two major house dust mite allergens Der p 1 and Der p 2.

    ID: 1493979

    Description: epitope description:KGTTGVRNT host organism:Homo sapiens

    Publication: 17964653;

  18. Mimotopes identify conformational B-cell epitopes on the two major house dust mite allergens Der p 1 and Der p 2.

    ID: 1493987

    Description: epitope description:SWWNLPQIG host organism:Homo sapiens

    Publication: 17964653;

  19. The immunogenicity of a conformationally restricted peptide mimetic of meningococcal lipooligosaccharide.

    ID: 1494001

    Description: epitope description:ACNTIGGYECGGGS host organism:Mus musculus C3H antibody name:anti-C22

    Publication: 16253126;

  20. Sequence analyses and antigenic epitope mapping of the putative RNA-directed RNA polymerase of five U.S. bluetongue viruses.

    ID: 1494010

    Description: epitope description:RRIRMKHGTKYRR antigen name:RNA-directed RNA polymerase host organism:Oryctolagus cuniculus

    Publication: 8525629;

  21. Immunogenicity of Bacillus anthracis protective antigen domains and efficacy of elicited antibody responses depend on host genetic background.

    ID: 1494015

    Description: epitope description:EIEDTEGLKEVIN antigen name:Protective antigen host organism:Mus musculus BALB/c

    Publication: 18480236;

  22. Sequence analyses and antigenic epitope mapping of the putative RNA-directed RNA polymerase of five U.S. bluetongue viruses.

    ID: 1494027

    Description: epitope description:RRIRMKHGTKYRR antigen name:RNA-directed RNA polymerase host organism:Oryctolagus cuniculus

    Publication: 8525629;

  23. Sequence analyses and antigenic epitope mapping of the putative RNA-directed RNA polymerase of five U.S. bluetongue viruses.

    ID: 1494028

    Description: epitope description:RRIRMKHGTKYRR antigen name:RNA-directed RNA polymerase host organism:Oryctolagus cuniculus

    Publication: 8525629;

  24. Sequence analyses and antigenic epitope mapping of the putative RNA-directed RNA polymerase of five U.S. bluetongue viruses.

    ID: 1494029

    Description: epitope description:RRIRMKHGTKYRR antigen name:RNA-directed RNA polymerase host organism:Oryctolagus cuniculus

    Publication: 8525629;

  25. Sequence analyses and antigenic epitope mapping of the putative RNA-directed RNA polymerase of five U.S. bluetongue viruses.

    ID: 1494039

    Description: epitope description:KKRFGPRLRDKDLIK antigen name:RNA-directed RNA polymerase host organism:Oryctolagus cuniculus

    Publication: 8525629;

  26. Sequence analyses and antigenic epitope mapping of the putative RNA-directed RNA polymerase of five U.S. bluetongue viruses.

    ID: 1494048

    Description: epitope description:KKKMKIVVTDDAKKRYKIRLQRFR antigen name:RNA-directed RNA polymerase host organism:Oryctolagus cuniculus

    Publication: 8525629;

  27. Immunogenicity of Bacillus anthracis protective antigen domains and efficacy of elicited antibody responses depend on host genetic background.

    ID: 1494051

    Description: epitope description:SENGD antigen name:Protective antigen host organism:Mus musculus BALB/c

    Publication: 18480236;

  28. Immunogenicity of Bacillus anthracis protective antigen domains and efficacy of elicited antibody responses depend on host genetic background.

    ID: 1494052

    Description: epitope description:SENGD antigen name:Protective antigen host organism:Mus musculus C57BL/6

    Publication: 18480236;

  29. Antibodies against synthetic epitopes inhibit the enzymatic activity of mutalysin II, a metalloproteinase from bushmaster snake venom.

    ID: 1494069

    Description: epitope description:VVADHGMFTKYN antigen name:Snake venom metalloproteinase hemorrhagic factor 2 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 17014879;

  30. Antibodies against synthetic epitopes inhibit the enzymatic activity of mutalysin II, a metalloproteinase from bushmaster snake venom.

    ID: 1494076

    Description: epitope description:VHEIVNTLNGFY antigen name:Snake venom metalloproteinase hemorrhagic factor 2 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 17014879;

  31. Antibodies against synthetic epitopes inhibit the enzymatic activity of mutalysin II, a metalloproteinase from bushmaster snake venom.

    ID: 1494081

    Description: epitope description:NILISLTDLEIW antigen name:Snake venom metalloproteinase hemorrhagic factor 2 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 17014879;

  32. Antibodies against synthetic epitopes inhibit the enzymatic activity of mutalysin II, a metalloproteinase from bushmaster snake venom.

    ID: 1494091

    Description: epitope description:FGEWRERVLLNR antigen name:Snake venom metalloproteinase hemorrhagic factor 2 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 17014879;

  33. Antibodies against synthetic epitopes inhibit the enzymatic activity of mutalysin II, a metalloproteinase from bushmaster snake venom.

    ID: 1494111

    Description: epitope description:VTMAHELGHNLG antigen name:Snake venom metalloproteinase hemorrhagic factor 2 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 17014879;

  34. Antibodies against synthetic epitopes inhibit the enzymatic activity of mutalysin II, a metalloproteinase from bushmaster snake venom.

    ID: 1494112

    Description: epitope description:AHELGHNLGMKH antigen name:Snake venom metalloproteinase hemorrhagic factor 2 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 17014879;

  35. Antibodies against synthetic epitopes inhibit the enzymatic activity of mutalysin II, a metalloproteinase from bushmaster snake venom.

    ID: 1494117

    Description: epitope description:HCHCSASFCIMP antigen name:Snake venom metalloproteinase hemorrhagic factor 2 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 17014879;

  36. Antibodies against synthetic epitopes inhibit the enzymatic activity of mutalysin II, a metalloproteinase from bushmaster snake venom.

    ID: 1494119

    Description: epitope description:SFCIMPPSISEG antigen name:Snake venom metalloproteinase hemorrhagic factor 2 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 17014879;

  37. Antibodies against synthetic epitopes inhibit the enzymatic activity of mutalysin II, a metalloproteinase from bushmaster snake venom.

    ID: 1494127

    Description: epitope description:YQMFLTKRKPQC antigen name:Snake venom metalloproteinase hemorrhagic factor 2 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 17014879;

  38. Complexity of the single linear neutralization epitope of the mouse arterivirus lactate dehydrogenase-elevating virus.

    ID: 1494137

    Description: epitope description:AVAADNSSTKNLTSNLTLCELNVTGFQQHF host organism:Mus musculus BALB/c antibody name:159-7, 12, 18, 19, H12

    Publication: 11882995;

  39. A monoclonal antibody that recognizes a potential coeliac-toxic repetitive pentapeptide epitope in gliadins.

    ID: 1494156

    Description: epitope description:QQPFP antigen name:Secale cereale (rye) protein host organism:Mus musculus antibody name:R5

    Publication: 11711775;

  40. A monoclonal antibody that recognizes a potential coeliac-toxic repetitive pentapeptide epitope in gliadins.

    ID: 1494157

    Description: epitope description:QQPFP antigen name:Secale cereale (rye) protein host organism:Mus musculus antibody name:R5

    Publication: 11711775;

  41. A monoclonal antibody that recognizes a potential coeliac-toxic repetitive pentapeptide epitope in gliadins.

    ID: 1494159

    Description: epitope description:QQPFP antigen name:Secale cereale (rye) protein host organism:Mus musculus antibody name:R5

    Publication: 11711775;

  42. Complexity of the single linear neutralization epitope of the mouse arterivirus lactate dehydrogenase-elevating virus.

    ID: 1494163

    Description: epitope description:ACVAGDSSTKNLIYTSTLCELNVTGFQQHF antigen name:major structural glycoprotein GP5 host organism:Mus musculus BALB/c antibody name:159-...

    Publication: 11882995;

  43. Complexity of the single linear neutralization epitope of the mouse arterivirus lactate dehydrogenase-elevating virus.

    ID: 1494168

    Description: epitope description:ACGASNSSTKNLIKNLTLCELNVTGFQQHF antigen name:major structural glycoprotein GP5 host organism:Mus musculus BALB/c

    Publication: 11882995;

  44. Complexity of the single linear neutralization epitope of the mouse arterivirus lactate dehydrogenase-elevating virus.

    ID: 1494169

    Description: epitope description:ACGASNSSTKNLIKNLTLCELNVTGFQQHF antigen name:major structural glycoprotein GP5 host organism:Mus musculus BALB/c antibody name:159-...

    Publication: 11882995;

  45. Complexity of the single linear neutralization epitope of the mouse arterivirus lactate dehydrogenase-elevating virus.

    ID: 1494184

    Description: epitope description:SSTKNLIYTSTLCELNVTGF antigen name:major structural glycoprotein GP5 host organism:Mus musculus BALB/c

    Publication: 11882995;

  46. Complexity of the single linear neutralization epitope of the mouse arterivirus lactate dehydrogenase-elevating virus.

    ID: 1494187

    Description: epitope description:SSTKNLIYNLTLCELNVTGFQQ antigen name:major structural glycoprotein GP5 host organism:Mus musculus BALB/c antibody name:159-7, 12, 1...

    Publication: 11882995;

  47. Complexity of the single linear neutralization epitope of the mouse arterivirus lactate dehydrogenase-elevating virus.

    ID: 1494188

    Description: epitope description:SSTKNLIY antigen name:major structural glycoprotein GP5 host organism:Mus musculus BALB/c

    Publication: 11882995;

  48. Complexity of the single linear neutralization epitope of the mouse arterivirus lactate dehydrogenase-elevating virus.

    ID: 1494189

    Description: epitope description:SSTKNLIY antigen name:major structural glycoprotein GP5 host organism:Mus musculus BALB/c antibody name:159-18, 159-19, B6501 A4, ...

    Publication: 11882995;

  49. Bovine immune response to inoculation with Neospora caninum surface antigen SRS2 lipopeptides mimics immune response to infection with live parasites.

    ID: 1494272

    Description: epitope description:EWVTGTLQQGIKITIPDEH antigen name:SRS domain-containing protein host organism:Bos taurus Holstein-Friesian

    Publication: 18305105;

  50. Fine specificity of the murine immune response to SV40 large tumour antigen utilizing synthetic peptides that define selected epitopes.

    ID: 1494305

    Description: epitope description:CGETGIDSQSQGSFQAPQSSNS host organism:Mus musculus C57BL/6 X BALB/c antibody name:anti-SV40 T-ag

    Publication: 7516272;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston