Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Identification of epitopes on a mutant form of Pseudomonas exotoxin using serum from humans treated with Pseudomonas exotoxin containing immunotoxins.

    ID: 1271703

    Description: epitope description:EIKASGGPEGGSLAALTAHQ host organism:Homo sapiens

    Publication: 9209499;

  2. A dominant linear B-cell epitope of ricin A-chain is the target of a neutralizing antibody response in Hodgkin's lymphoma patients treated with an ant...

    ID: 1271718

    Description: epitope description:YTNFIRAVRGRLTTGADVRHEIPVLPNRVG antigen name:rRNA N-glycosidase (UniProt:B9T8T0) host organism:Homo sapiens antibody name:HARA

    Publication: 15086403;

  3. A dominant linear B-cell epitope of ricin A-chain is the target of a neutralizing antibody response in Hodgkin's lymphoma patients treated with an ant...

    ID: 1271720

    Description: epitope description:ELSNHAELSVTLALDVTNAYVVGYRAGNSA antigen name:rRNA N-glycosidase (UniProt:B9T8T0) host organism:Homo sapiens antibody name:HARA

    Publication: 15086403;

  4. A dominant linear B-cell epitope of ricin A-chain is the target of a neutralizing antibody response in Hodgkin's lymphoma patients treated with an ant...

    ID: 1271721

    Description: epitope description:VVGYRAGNSAYFFHPDNQEDAEAITHLFTD antigen name:rRNA N-glycosidase (UniProt:B9T8T0) host organism:Homo sapiens antibody name:HARA

    Publication: 15086403;

  5. The disaccharide L-alpha-D-heptose1-->7-L-alpha-D-heptose1-->of the inner core domain of Salmonella lipopolysaccharide is accessible to antibody and i...

    ID: 1271723

    Description: epitope description:L-glycero-alpha-D-manno-heptosyl-(1->7)-L-glycero-alpha-D-manno-heptosyl group antigen name:lipopolysaccharide host organism:Mus m...

    Publication: 1383323;

  6. A dominant linear B-cell epitope of ricin A-chain is the target of a neutralizing antibody response in Hodgkin's lymphoma patients treated with an ant...

    ID: 1271727

    Description: epitope description:FQYIEGEMRTRIRYNRRSAPDPSVITLENS antigen name:rRNA N-glycosidase (UniProt:B9T8T0) host organism:Homo sapiens antibody name:HARA

    Publication: 15086403;

  7. A dominant linear B-cell epitope of ricin A-chain is the target of a neutralizing antibody response in Hodgkin's lymphoma patients treated with an ant...

    ID: 1271730

    Description: epitope description:SNQGAFASPIQLQRRNGSKFSVYDVSILIPI antigen name:rRNA N-glycosidase (UniProt:B9T8T0) host organism:Homo sapiens antibody name:HARA

    Publication: 15086403;

  8. Immunodominant epitope in the C-terminus of a variable major protein in Borrelia duttonii, an agent of tick-borne relapsing fever.

    ID: 1271804

    Description: epitope description:KAFQGIMDTAGKEGVAKPEVGNTTVKIDNA antigen name:Variable major outer membrane lipoprotein host organism:Oryctolagus cuniculus Japanese...

    Publication: 16625051;

  9. Immunodominant epitope in the C-terminus of a variable major protein in Borrelia duttonii, an agent of tick-borne relapsing fever.

    ID: 1271807

    Description: epitope description:KTGKLASGAVDKSQGGKEEVQKVGVAAVNK antigen name:Variable major outer membrane lipoprotein host organism:Oryctolagus cuniculus Japanese...

    Publication: 16625051;

  10. Immunodominant epitope in the C-terminus of a variable major protein in Borrelia duttonii, an agent of tick-borne relapsing fever.

    ID: 1271808

    Description: epitope description:ATQDTKKQDVGEYFD antigen name:Variable major outer membrane lipoprotein host organism:Oryctolagus cuniculus Japanese white

    Publication: 16625051;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston