Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. A human monoclonal antibody specific for the N terminus of the hepatitis C virus nucleocapsid protein.

    ID: 1275767

    Description: epitope description:GGQIVGGVYLLPRRGPRLGVRATRKTSERSQPR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7505020;

  2. A human monoclonal antibody specific for the N terminus of the hepatitis C virus nucleocapsid protein.

    ID: 1275768

    Description: epitope description:GVYLLPRRGPRLGVRATRKT antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7505020;

  3. Three-dimensional structures of single-chain Fv-neuraminidase complexes.

    ID: 1275786

    Description: epitope description:P330, N331, D332, P333, T334, Y342, P343, G344, N345, I367, I369, A370, S371, N400, T401, W403, K434 antigen name:Neuraminidase ho...

    Publication: 9642070;

  4. Mapping of B-cell epitopes in the nucleocapsid protein of Puumala hantavirus.

    ID: 1275798

    Description: epitope description:EDINGIRRPKHLYV antigen name:Puumala orthohantavirus protein host organism:Myodes glareolus

    Publication: 11952140;

  5. Mapping of B-cell epitopes in the nucleocapsid protein of Puumala hantavirus.

    ID: 1275800

    Description: epitope description:NKNTLQARQQTVSA antigen name:Puumala orthohantavirus protein host organism:Myodes glareolus

    Publication: 11952140;

  6. Mapping of B-cell epitopes in the nucleocapsid protein of Puumala hantavirus.

    ID: 1275803

    Description: epitope description:TDPTGIEPDDHLKE antigen name:Puumala orthohantavirus protein host organism:Myodes glareolus

    Publication: 11952140;

  7. Mapping of B-cell epitopes in the nucleocapsid protein of Puumala hantavirus.

    ID: 1275804

    Description: epitope description:QQLIVARQKLKDAE antigen name:Puumala orthohantavirus protein host organism:Myodes glareolus

    Publication: 11952140;

  8. Characterization of antigenic determinants in the core antigen of the hepatitis C virus.

    ID: 1275818

    Description: epitope description:MSTNPKPQKKNKRNTNRRPQDV antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7526540;

  9. Expression and immunogenicity of a streptococcal M protein epitope inserted in Salmonella flagellin.

    ID: 1275938

    Description: epitope description:AVTRGTINDPQRAKE antigen name:UniProt:A2RGM0 host organism:Mus musculus BALB/c

    Publication: 2037377;

  10. Expression and immunogenicity of a streptococcal M protein epitope inserted in Salmonella flagellin.

    ID: 1275948

    Description: epitope description:AVTRGTINDPQRAKE antigen name:UniProt:A2RGM0 host organism:Mus musculus BALB/c

    Publication: 2037377;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston