Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271419

    Description: epitope description:HRELWAKI antigen name:Invasin IpaD host organism:Macaca mulatta

    Publication: 9573082;

  2. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271430

    Description: epitope description:INDINEQY antigen name:Invasin IpaD host organism:Macaca mulatta

    Publication: 9573082;

  3. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271434

    Description: epitope description:NEQYLKVY antigen name:Invasin IpaD host organism:Macaca mulatta

    Publication: 9573082;

  4. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271437

    Description: epitope description:YLKVYEHA antigen name:Invasin IpaD host organism:Macaca mulatta

    Publication: 9573082;

  5. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271439

    Description: epitope description:KVYEHAVS antigen name:Invasin IpaD host organism:Macaca mulatta

    Publication: 9573082;

  6. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271442

    Description: epitope description:EHAVSSYT antigen name:Invasin IpaD host organism:Macaca mulatta

    Publication: 9573082;

  7. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271452

    Description: epitope description:YQDFSAVL antigen name:Invasin IpaD host organism:Macaca mulatta

    Publication: 9573082;

  8. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271461

    Description: epitope description:SLAGWISP antigen name:Invasin IpaD host organism:Macaca mulatta

    Publication: 9573082;

  9. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271467

    Description: epitope description:SPGGNDGN antigen name:Invasin IpaD host organism:Macaca mulatta

    Publication: 9573082;

  10. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271471

    Description: epitope description:NDGNSVKL antigen name:Invasin IpaD host organism:Macaca mulatta

    Publication: 9573082;

  11. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271484

    Description: epitope description:KKALEELK antigen name:Invasin IpaD host organism:Macaca mulatta

    Publication: 9573082;

  12. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271485

    Description: epitope description:KALEELKE antigen name:Invasin IpaD host organism:Macaca mulatta

    Publication: 9573082;

  13. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271491

    Description: epitope description:KEKYKDKP antigen name:Invasin IpaD host organism:Macaca mulatta

    Publication: 9573082;

  14. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271493

    Description: epitope description:KYKDKPLY antigen name:Invasin IpaD host organism:Macaca mulatta

    Publication: 9573082;

  15. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271494

    Description: epitope description:YKDKPLYP antigen name:Invasin IpaD host organism:Macaca mulatta

    Publication: 9573082;

  16. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271496

    Description: epitope description:DKPLYPAN antigen name:Invasin IpaD host organism:Macaca mulatta

    Publication: 9573082;

  17. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271501

    Description: epitope description:PANNTVSQ antigen name:Invasin IpaD host organism:Macaca mulatta

    Publication: 9573082;

  18. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271509

    Description: epitope description:EQANKWLT antigen name:Invasin IpaD host organism:Macaca mulatta

    Publication: 9573082;

  19. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271511

    Description: epitope description:ANKWLTEL antigen name:Invasin IpaD host organism:Macaca mulatta

    Publication: 9573082;

  20. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271520

    Description: epitope description:GTIGKVSQ antigen name:Invasin IpaD host organism:Macaca mulatta

    Publication: 9573082;

  21. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271523

    Description: epitope description:GKVSQKNG antigen name:Invasin IpaD host organism:Macaca mulatta

    Publication: 9573082;

  22. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271526

    Description: epitope description:SQKNGGYV antigen name:Invasin IpaD host organism:Macaca mulatta

    Publication: 9573082;

  23. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271528

    Description: epitope description:KNGGYVVS antigen name:Invasin IpaD host organism:Macaca mulatta

    Publication: 9573082;

  24. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271530

    Description: epitope description:GGYVVSIN antigen name:Invasin IpaD host organism:Macaca mulatta

    Publication: 9573082;

  25. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271531

    Description: epitope description:GYVVSINM antigen name:Invasin IpaD host organism:Macaca mulatta

    Publication: 9573082;

  26. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271539

    Description: epitope description:TPIDNMLK antigen name:Invasin IpaD host organism:Macaca mulatta

    Publication: 9573082;

  27. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271541

    Description: epitope description:IDNMLKSL antigen name:Invasin IpaD host organism:Macaca mulatta

    Publication: 9573082;

  28. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271547

    Description: epitope description:LKSLDNLG antigen name:Invasin IpaD host organism:Macaca mulatta

    Publication: 9573082;

  29. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271555

    Description: epitope description:GNGEVVLD antigen name:Invasin IpaD host organism:Macaca mulatta

    Publication: 9573082;

  30. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271560

    Description: epitope description:VLDNAKYQ antigen name:Invasin IpaD host organism:Macaca mulatta

    Publication: 9573082;

  31. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271565

    Description: epitope description:KYQAWNAG antigen name:Invasin IpaD host organism:Macaca mulatta

    Publication: 9573082;

  32. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271566

    Description: epitope description:YQAWNAGF antigen name:Invasin IpaD host organism:Macaca mulatta

    Publication: 9573082;

  33. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271568

    Description: epitope description:AWNAGFSA antigen name:Invasin IpaD host organism:Macaca mulatta

    Publication: 9573082;

  34. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271578

    Description: epitope description:TMKNNLQT antigen name:Invasin IpaD host organism:Macaca mulatta

    Publication: 9573082;

  35. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271579

    Description: epitope description:MKNNLQTL antigen name:Invasin IpaD host organism:Macaca mulatta

    Publication: 9573082;

  36. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271583

    Description: epitope description:LQTLVQKY antigen name:Invasin IpaD host organism:Macaca mulatta

    Publication: 9573082;

  37. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271584

    Description: epitope description:QTLVQKYS antigen name:Invasin IpaD host organism:Macaca mulatta

    Publication: 9573082;

  38. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271605

    Description: epitope description:SSTISSCT antigen name:Invasin IpaD host organism:Macaca mulatta

    Publication: 9573082;

  39. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271606

    Description: epitope description:STISSCTD antigen name:Invasin IpaD host organism:Macaca mulatta

    Publication: 9573082;

  40. Identification of epitope and surface-exposed domains of Shigella flexneri invasion plasmid antigen D (IpaD).

    ID: 1271609

    Description: epitope description:SSCTDTDK antigen name:Invasin IpaD host organism:Macaca mulatta

    Publication: 9573082;

  41. Identification of epitopes on a mutant form of Pseudomonas exotoxin using serum from humans treated with Pseudomonas exotoxin containing immunotoxins.

    ID: 1271703

    Description: epitope description:EIKASGGPEGGSLAALTAHQ host organism:Homo sapiens

    Publication: 9209499;

  42. A dominant linear B-cell epitope of ricin A-chain is the target of a neutralizing antibody response in Hodgkin's lymphoma patients treated with an ant...

    ID: 1271718

    Description: epitope description:YTNFIRAVRGRLTTGADVRHEIPVLPNRVG antigen name:rRNA N-glycosidase (UniProt:B9T8T0) host organism:Homo sapiens antibody name:HARA

    Publication: 15086403;

  43. A dominant linear B-cell epitope of ricin A-chain is the target of a neutralizing antibody response in Hodgkin's lymphoma patients treated with an ant...

    ID: 1271720

    Description: epitope description:ELSNHAELSVTLALDVTNAYVVGYRAGNSA antigen name:rRNA N-glycosidase (UniProt:B9T8T0) host organism:Homo sapiens antibody name:HARA

    Publication: 15086403;

  44. A dominant linear B-cell epitope of ricin A-chain is the target of a neutralizing antibody response in Hodgkin's lymphoma patients treated with an ant...

    ID: 1271721

    Description: epitope description:VVGYRAGNSAYFFHPDNQEDAEAITHLFTD antigen name:rRNA N-glycosidase (UniProt:B9T8T0) host organism:Homo sapiens antibody name:HARA

    Publication: 15086403;

  45. The disaccharide L-alpha-D-heptose1-->7-L-alpha-D-heptose1-->of the inner core domain of Salmonella lipopolysaccharide is accessible to antibody and i...

    ID: 1271723

    Description: epitope description:L-glycero-alpha-D-manno-heptosyl-(1->7)-L-glycero-alpha-D-manno-heptosyl group antigen name:lipopolysaccharide host organism:Mus m...

    Publication: 1383323;

  46. A dominant linear B-cell epitope of ricin A-chain is the target of a neutralizing antibody response in Hodgkin's lymphoma patients treated with an ant...

    ID: 1271727

    Description: epitope description:FQYIEGEMRTRIRYNRRSAPDPSVITLENS antigen name:rRNA N-glycosidase (UniProt:B9T8T0) host organism:Homo sapiens antibody name:HARA

    Publication: 15086403;

  47. A dominant linear B-cell epitope of ricin A-chain is the target of a neutralizing antibody response in Hodgkin's lymphoma patients treated with an ant...

    ID: 1271730

    Description: epitope description:SNQGAFASPIQLQRRNGSKFSVYDVSILIPI antigen name:rRNA N-glycosidase (UniProt:B9T8T0) host organism:Homo sapiens antibody name:HARA

    Publication: 15086403;

  48. Immunodominant epitope in the C-terminus of a variable major protein in Borrelia duttonii, an agent of tick-borne relapsing fever.

    ID: 1271804

    Description: epitope description:KAFQGIMDTAGKEGVAKPEVGNTTVKIDNA antigen name:Variable major outer membrane lipoprotein host organism:Oryctolagus cuniculus Japanese...

    Publication: 16625051;

  49. Immunodominant epitope in the C-terminus of a variable major protein in Borrelia duttonii, an agent of tick-borne relapsing fever.

    ID: 1271807

    Description: epitope description:KTGKLASGAVDKSQGGKEEVQKVGVAAVNK antigen name:Variable major outer membrane lipoprotein host organism:Oryctolagus cuniculus Japanese...

    Publication: 16625051;

  50. Immunodominant epitope in the C-terminus of a variable major protein in Borrelia duttonii, an agent of tick-borne relapsing fever.

    ID: 1271808

    Description: epitope description:ATQDTKKQDVGEYFD antigen name:Variable major outer membrane lipoprotein host organism:Oryctolagus cuniculus Japanese white

    Publication: 16625051;

  51. Immunodominant epitope in the C-terminus of a variable major protein in Borrelia duttonii, an agent of tick-borne relapsing fever.

    ID: 1271815

    Description: epitope description:NLSVKIGSASKELED antigen name:Variable major outer membrane lipoprotein host organism:Oryctolagus cuniculus Japanese white

    Publication: 16625051;

  52. Immunodominant epitope in the C-terminus of a variable major protein in Borrelia duttonii, an agent of tick-borne relapsing fever.

    ID: 1271822

    Description: epitope description:SNKEGVAADGDALNK antigen name:Variable major outer membrane lipoprotein host organism:Oryctolagus cuniculus Japanese white

    Publication: 16625051;

  53. Immunodominant epitope in the C-terminus of a variable major protein in Borrelia duttonii, an agent of tick-borne relapsing fever.

    ID: 1271839

    Description: epitope description:VEDIMKKTVKEILKK antigen name:Variable major outer membrane lipoprotein host organism:Oryctolagus cuniculus Japanese white

    Publication: 16625051;

  54. Protection against H1, H5, H6 and H9 influenza A infection with liposomal matrix 2 epitope vaccines.

    ID: 1271871

    Description: epitope description:MSLLTEVETPIRNEWGCRCNDSSD antigen name:Matrix protein 2 host organism:Mus musculus BALB/c

    Publication: 16713037;

  55. Protection against H1, H5, H6 and H9 influenza A infection with liposomal matrix 2 epitope vaccines.

    ID: 1271878

    Description: epitope description:MSLLTEVETLTRNGWGCRCSDSSD antigen name:Matrix protein 2 host organism:Mus musculus BALB/c

    Publication: 16713037;

  56. Conserved T and B cell epitopes on the M protein of group A streptococci. Induction of bactericidal antibodies.

    ID: 1275691

    Description: epitope description:PFFTAAALTVMATAGVAAVV antigen name:UniProt:A2RGM0 host organism:Mus musculus C57BL/10

    Publication: 1383324;

  57. Opsonic human antibodies from an endemic population specific for a conserved epitope on the M protein of group A streptococci.

    ID: 1275710

    Description: epitope description:RRDLDASREAKK antigen name:UniProt:A2RGM0 host organism:Homo sapiens Australian Aboriginal

    Publication: 8958044;

  58. Detection of species specific epitopes of mouse and hamster prion proteins (PrPs) by anti-peptide antibodies.

    ID: 1275758

    Description: epitope description:KPSKPKTNMKHMAGAA antigen name:Mesocricetus auratus (Syrian golden hamster) protein host organism:Oryctolagus cuniculus antibody na...

    Publication: 8645112;

  59. A human monoclonal antibody specific for the N terminus of the hepatitis C virus nucleocapsid protein.

    ID: 1275761

    Description: epitope description:MSTNPKPQRKTKRNTNRRPQDV antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7505020;

  60. A human monoclonal antibody specific for the N terminus of the hepatitis C virus nucleocapsid protein.

    ID: 1275766

    Description: epitope description:KFPGGGQIVGGVYLLPRRG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7505020;

  61. A human monoclonal antibody specific for the N terminus of the hepatitis C virus nucleocapsid protein.

    ID: 1275767

    Description: epitope description:GGQIVGGVYLLPRRGPRLGVRATRKTSERSQPR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7505020;

  62. A human monoclonal antibody specific for the N terminus of the hepatitis C virus nucleocapsid protein.

    ID: 1275768

    Description: epitope description:GVYLLPRRGPRLGVRATRKT antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7505020;

  63. Three-dimensional structures of single-chain Fv-neuraminidase complexes.

    ID: 1275786

    Description: epitope description:P330, N331, D332, P333, T334, Y342, P343, G344, N345, I367, I369, A370, S371, N400, T401, W403, K434 antigen name:Neuraminidase ho...

    Publication: 9642070;

  64. Mapping of B-cell epitopes in the nucleocapsid protein of Puumala hantavirus.

    ID: 1275798

    Description: epitope description:EDINGIRRPKHLYV antigen name:Puumala orthohantavirus protein host organism:Myodes glareolus

    Publication: 11952140;

  65. Mapping of B-cell epitopes in the nucleocapsid protein of Puumala hantavirus.

    ID: 1275800

    Description: epitope description:NKNTLQARQQTVSA antigen name:Puumala orthohantavirus protein host organism:Myodes glareolus

    Publication: 11952140;

  66. Mapping of B-cell epitopes in the nucleocapsid protein of Puumala hantavirus.

    ID: 1275803

    Description: epitope description:TDPTGIEPDDHLKE antigen name:Puumala orthohantavirus protein host organism:Myodes glareolus

    Publication: 11952140;

  67. Mapping of B-cell epitopes in the nucleocapsid protein of Puumala hantavirus.

    ID: 1275804

    Description: epitope description:QQLIVARQKLKDAE antigen name:Puumala orthohantavirus protein host organism:Myodes glareolus

    Publication: 11952140;

  68. Characterization of antigenic determinants in the core antigen of the hepatitis C virus.

    ID: 1275818

    Description: epitope description:MSTNPKPQKKNKRNTNRRPQDV antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7526540;

  69. Expression and immunogenicity of a streptococcal M protein epitope inserted in Salmonella flagellin.

    ID: 1275938

    Description: epitope description:AVTRGTINDPQRAKE antigen name:UniProt:A2RGM0 host organism:Mus musculus BALB/c

    Publication: 2037377;

  70. Expression and immunogenicity of a streptococcal M protein epitope inserted in Salmonella flagellin.

    ID: 1275948

    Description: epitope description:AVTRGTINDPQRAKE antigen name:UniProt:A2RGM0 host organism:Mus musculus BALB/c

    Publication: 2037377;

  71. Antigen distortion allows influenza virus to escape neutralization.

    ID: 1275968

    Description: epitope description:G145, V146, T147, Q148, N149, G150, G151, S152, N153, T171, K172, S173, G174, S175, E206, S209, L210 antigen name:Hemagglutinin ho...

    Publication: 9461077;

  72. Template-based coiled-coil antigens elicit neutralizing antibodies to the SARS-coronavirus.

    ID: 1276000

    Description: epitope description:T921, T922, T923, T925, A926, G928, K929, L930, D932, V933, N935, Q936, N937, Q939, A940, N942, T943, L944 antigen name:Spike glyc...

    Publication: 16697221;

  73. Template-based coiled-coil antigens elicit neutralizing antibodies to the SARS-coronavirus.

    ID: 1276002

    Description: epitope description:T921, T922, T923, T925, A926, G928, K929, L930, D932, V933, N935, Q936, N937, Q939, A940, N942, T943, L944 antigen name:Spike glyc...

    Publication: 16697221;

  74. Template-based coiled-coil antigens elicit neutralizing antibodies to the SARS-coronavirus.

    ID: 1276004

    Description: epitope description:Q917, E918, S919, T921, T922, S924, T925, A926, G928, K929, Q931, D932, V933, N935, Q936, A938, Q939, A940 antigen name:Spike glyc...

    Publication: 16697221;

  75. Template-based coiled-coil antigens elicit neutralizing antibodies to the SARS-coronavirus.

    ID: 1276010

    Description: epitope description:N1155, A1156, S1157, V1159, N1160, Q1162, K1163, E1164, D1166, R1167, N1169, E1170, V1171, K1173, N1174, N1176, E1177, S1178 antig...

    Publication: 16697221;

  76. Template-based coiled-coil antigens elicit neutralizing antibodies to the SARS-coronavirus.

    ID: 1276013

    Description: epitope description:Q1162, K1163, E1164, D1166, R1167, N1169, E1170, V1171, K1173, N1174, N1176, E1177, S1178, I1180, D1181, Q1183, E1184, L1185 antig...

    Publication: 16697221;

  77. Antigenic characterization of an abnormal isoform of prion protein using a new diverse panel of monoclonal antibodies.

    ID: 1276062

    Description: epitope description:WGQPHGGGWGQPHGGSWGQPHGGSWGQPHGGGWGQ antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:mAbs 8, 37,...

    Publication: 15003861;

  78. Antigenic characterization of an abnormal isoform of prion protein using a new diverse panel of monoclonal antibodies.

    ID: 1276070

    Description: epitope description:RYYRE antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:mAb 32, 149

    Publication: 15003861;

  79. Antibody to E1 peptide of hepatitis C virus genotype 4 inhibits virus binding and entry to HepG2 cells in vitro.

    ID: 1276080

    Description: epitope description:GHRMAWDMM antigen name:Genome polyprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 16688798;

  80. Opsonic human antibodies from an endemic population specific for a conserved epitope on the M protein of group A streptococci.

    ID: 1276127

    Description: epitope description:ASREAKKQVEKA antigen name:UniProt:A2RGM0 host organism:Homo sapiens Australian Aboriginal

    Publication: 8958044;

  81. Antigenic characterization of an abnormal isoform of prion protein using a new diverse panel of monoclonal antibodies.

    ID: 1276137

    Description: epitope description:KESQAYYDGRR antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:mAbs 39, 147

    Publication: 15003861;

  82. Hepatitis E virus: identification of type-common epitopes.

    ID: 1276200

    Description: epitope description:ANPPDHSAPLGVTRPSAPPLPHVVDLPQLGPRR antigen name:Protein ORF3 host organism:Homo sapiens antibody name:F387-C

    Publication: 1717709;

  83. Analysis of antigenicity of Clostridium botulinum type C1 and D toxins by polyclonal and monoclonal antibodies.

    ID: 1276215

    Description: epitope description:MTWPVKDFNYSDPVNDNDILYLRIPQNKLITTPVKAFMITQNIWVIPERFSSDTNPSLSKPPRPTSKYQSYYDPSYLSTDEQKDTFLKGIIKLFKRINERDIGKKLINYLVVGSPFMGDSSTPEDTFDFT...

    Publication: 6198281;

  84. Analysis of antigenicity of Clostridium botulinum type C1 and D toxins by polyclonal and monoclonal antibodies.

    ID: 1276216

    Description: epitope description:MTWPVKDFNYSDPVNDNDILYLRIPQNKLITTPVKAFMITQNIWVIPERFSSDTNPSLSKPPRPTSKYQSYYDPSYLSTDEQKDTFLKGIIKLFKRINERDIGKKLINYLVVGSPFMGDSSTPEDTFDFT...

    Publication: 6198281;

  85. Expression and immunoreactivity of HCV/HBV epitopes.

    ID: 1276317

    Description: epitope description:CTTPAQGNSMFPSCCCTKPTDGNC antigen name:Large envelope protein host organism:Homo sapiens antibody name:anti-HBs

    Publication: 16425413;

  86. Mapping of protective and cross-reactive domains of the type A neurotoxin of Clostridium botulinum.

    ID: 1276322

    Description: epitope description:VNKQFNYKDPVNGVDIAYIKIPNVGQMQPVKAFKIHNKIWVIPERDTFTNPEEGDLNPPPEAKQVPVSYYDSTYLSTDNEKDNYLKGVTKLFERIYSTDLGRMLLTSIVRGIPFWGGSTIDTELK anti...

    Publication: 9014296;

  87. Linear B-cell epitopes of the NS3-NS4-NS5 proteins of the hepatitis C virus as modeled with synthetic peptides.

    ID: 1276344

    Description: epitope description:KPAIIPDREVLYREFDEMEE antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7530398;

  88. Linear B-cell epitopes of the NS3-NS4-NS5 proteins of the hepatitis C virus as modeled with synthetic peptides.

    ID: 1276345

    Description: epitope description:LYREFDEMEECSQHLPYIEQ antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7530398;

  89. Linear B-cell epitopes of the NS3-NS4-NS5 proteins of the hepatitis C virus as modeled with synthetic peptides.

    ID: 1276349

    Description: epitope description:AFASRGNHVSPTHYVPESDA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7530398;

  90. Linear B-cell epitopes of the NS3-NS4-NS5 proteins of the hepatitis C virus as modeled with synthetic peptides.

    ID: 1276354

    Description: epitope description:AVLTSMLTDPSHITAETAKR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7530398;

  91. Linear B-cell epitopes of the NS3-NS4-NS5 proteins of the hepatitis C virus as modeled with synthetic peptides.

    ID: 1276368

    Description: epitope description:DVESYSSMPPLEGEPGDPDL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7530398;

  92. Linear B-cell epitopes of the NS3-NS4-NS5 proteins of the hepatitis C virus as modeled with synthetic peptides.

    ID: 1276369

    Description: epitope description:YSSMPPLEGEPGDPDLSDGS antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7530398;

  93. Linear B-cell epitopes of the NS3-NS4-NS5 proteins of the hepatitis C virus as modeled with synthetic peptides.

    ID: 1276371

    Description: epitope description:AAEESKLPINPLSNSLLRH antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7530398;

  94. Linear B-cell epitopes of the NS3-NS4-NS5 proteins of the hepatitis C virus as modeled with synthetic peptides.

    ID: 1276376

    Description: epitope description:KATAACRAAKLQDCTMLVN antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7530398;

  95. Linear B-cell epitopes of the NS3-NS4-NS5 proteins of the hepatitis C virus as modeled with synthetic peptides.

    ID: 1276387

    Description: epitope description:SASQLSAPSLKATCTTHHDS antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7530398;

  96. Linear B-cell epitopes of the NS3-NS4-NS5 proteins of the hepatitis C virus as modeled with synthetic peptides.

    ID: 1276392

    Description: epitope description:EEACKLTPPHSAKSKFGYG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7530398;

  97. Mapping of protective and cross-reactive domains of the type A neurotoxin of Clostridium botulinum.

    ID: 1276402

    Description: epitope description:EVSFEELRTFGGHDAKFIDSLQENEFRLYYYNKFKDIASTLNKAKSIVGTTASLQYMKNVFKEKYLLSEDTSGKFSVDKLKFDKLYKMLTEIYTEDNFVKFFKVLNRKTYLNFDKAVFKINIVPKVNYTI...

    Publication: 9014296;

  98. Mapping of protective and cross-reactive domains of the type A neurotoxin of Clostridium botulinum.

    ID: 1276410

    Description: epitope description:ITIIIPYIGPALNIGNMLYKDDFVGALIFSGAVILLEFIPEIAIPVLGTFALVSYIANKVLTVQTIDNALSKRNEKWDEVYKYIVTNWLAKVNTQIDLIRKKMKEALENQAEATKAIINYQYNQYTEEEK...

    Publication: 9014296;

  99. Mapping of protective and cross-reactive domains of the type A neurotoxin of Clostridium botulinum.

    ID: 1276412

    Description: epitope description:ITIIIPYIGPALNIGNMLYKDDFVGALIFSGAVILLEFIPEIAIPVLGTFALVSYIANKVLTVQTIDNALSKRNEKWDEVYKYIVTNWLAKVNTQIDLIRKKMKEALENQAEATKAIINYQYNQYTEEEK...

    Publication: 9014296;

  100. Detection of prion epitopes on PrP and PrP of transmissible spongiform encephalopathies using specific monoclonal antibodies to PrP.

    ID: 1276418

    Description: epitope description:KTNMKHMAGA antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:2E7, 7C1, 6G4, 3F4

    Publication: 16266315;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston