Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Fine specificity of the murine immune response to SV40 large tumour antigen utilizing synthetic peptides that define selected epitopes.

    ID: 1494308

    Description: epitope description:FEDVKGTGGESRDLPSGQG antigen name:Macaca mulatta polyomavirus 1 protein host organism:Mus musculus C57BL/6 X BALB/c antibody name:a...

    Publication: 7516272;

  2. Fine specificity of the murine immune response to SV40 large tumour antigen utilizing synthetic peptides that define selected epitopes.

    ID: 1494310

    Description: epitope description:CRGFTSFKKPPTPPPEPET host organism:Mus musculus BALB/c antibody name:Pab 405, Pab 101

    Publication: 7516272;

  3. Fine specificity of the murine immune response to SV40 large tumour antigen utilizing synthetic peptides that define selected epitopes.

    ID: 1494324

    Description: epitope description:CRGFTSFKKPPTPPPEPET host organism:Mus musculus BALB/c

    Publication: 7516272;

  4. SV40 large tumor antigen associated synthetic peptides define native antigenic determinants and induce protective tumor immunity in mice.

    ID: 1494339

    Description: epitope description:CGETGIDSQSQGSFQAPQSSNS host organism:Mus musculus BALB/c

    Publication: 7523865;

  5. SV40 large tumor antigen associated synthetic peptides define native antigenic determinants and induce protective tumor immunity in mice.

    ID: 1494344

    Description: epitope description:FEDVKGTGGESRDLPSGQG antigen name:Macaca mulatta polyomavirus 1 protein host organism:Mus musculus BALB/c

    Publication: 7523865;

  6. SV40 large tumor antigen associated synthetic peptides define native antigenic determinants and induce protective tumor immunity in mice.

    ID: 1494348

    Description: epitope description:CGETGIDSQSQGSFQAPQSSNS host organism:Mus musculus BALB/c

    Publication: 7523865;

  7. Analysis of epitope-specific immune responses induced by vaccination with structurally folded and unfolded recombinant Bet v 1 allergen derivatives in...

    ID: 1494349

    Description: epitope description:MGVFNYETETTSVIPAARLFKAFI antigen name:Bet v 1 host organism:Homo sapiens

    Publication: 17911617;

  8. Human immune responses to synthetic peptides from the Epstein-Barr nuclear antigen.

    ID: 1494366

    Description: epitope description:IHSDEGPGTGPGNGLGE antigen name:Epstein-Barr nuclear antigen 1 host organism:Homo sapiens

    Publication: 2981091;

  9. Analysis of epitope-specific immune responses induced by vaccination with structurally folded and unfolded recombinant Bet v 1 allergen derivatives in...

    ID: 1494371

    Description: epitope description:LFPKVAPQAISSVENIEGNGGPGTIKKISF antigen name:Bet v 1 host organism:Homo sapiens

    Publication: 17911617;

  10. SV40 large tumor antigen associated synthetic peptides define native antigenic determinants and induce protective tumor immunity in mice.

    ID: 1494374

    Description: epitope description:CGETGIDSQSQGSFQAPQSSNS host organism:Mus musculus BALB/c

    Publication: 7523865;

  11. Analysis of epitope-specific immune responses induced by vaccination with structurally folded and unfolded recombinant Bet v 1 allergen derivatives in...

    ID: 1494375

    Description: epitope description:GPGTIKKISFPEGFPFKYVKDRVDEVDHTN antigen name:Bet v 1 host organism:Homo sapiens

    Publication: 17911617;

  12. Analysis of epitope-specific immune responses induced by vaccination with structurally folded and unfolded recombinant Bet v 1 allergen derivatives in...

    ID: 1494378

    Description: epitope description:GPGTIKKISFPEGFPFKYVKDRVDEVDHTN antigen name:Bet v 1 host organism:Homo sapiens

    Publication: 17911617;

  13. Analysis of epitope-specific immune responses induced by vaccination with structurally folded and unfolded recombinant Bet v 1 allergen derivatives in...

    ID: 1494383

    Description: epitope description:DGGSILKISNKYHTKGDHEVKAEQVKASKE antigen name:Bet v 1 host organism:Homo sapiens

    Publication: 17911617;

  14. Analysis of epitope-specific immune responses induced by vaccination with structurally folded and unfolded recombinant Bet v 1 allergen derivatives in...

    ID: 1494385

    Description: epitope description:DGGSILKISNKYHTKGDHEVKAEQVKASKE antigen name:Bet v 1 host organism:Homo sapiens

    Publication: 17911617;

  15. Analysis of epitope-specific immune responses induced by vaccination with structurally folded and unfolded recombinant Bet v 1 allergen derivatives in...

    ID: 1494387

    Description: epitope description:KAEQVKASKEMGETLLRAVESYLLAHSDAYN antigen name:Bet v 1 host organism:Homo sapiens

    Publication: 17911617;

  16. Analysis of epitope-specific immune responses induced by vaccination with structurally folded and unfolded recombinant Bet v 1 allergen derivatives in...

    ID: 1494390

    Description: epitope description:VDHTNFKYNYSVIEGGPIGDTLEKISNEIK antigen name:Bet v 1 host organism:Homo sapiens

    Publication: 17911617;

  17. Analysis of epitope-specific immune responses induced by vaccination with structurally folded and unfolded recombinant Bet v 1 allergen derivatives in...

    ID: 1494391

    Description: epitope description:VDHTNFKYNYSVIEGGPIGDTLEKISNEIK antigen name:Bet v 1 host organism:Homo sapiens

    Publication: 17911617;

  18. The latex allergen hev B 5 is an antigen with repetitive murine B-cell epitopes.

    ID: 1494405

    Description: epitope description:PAEGEK antigen name:Hev b 5 host organism:Mus musculus BALB/c antibody name:3G3, 6A10, 6F6

    Publication: 15241001;

  19. Immunisation with phage-displayed variable region 2 from meningococcal PorA outer membrane protein induces bactericidal antibodies against Neisseria m...

    ID: 1494408

    Description: epitope description:PIQNSKSAYTPAHYTRQNNADVFVPAVVGKPGS antigen name:Major outer membrane protein P.IA host organism:Mus musculus BALB/c

    Publication: 11578688;

  20. Immunisation with phage-displayed variable region 2 from meningococcal PorA outer membrane protein induces bactericidal antibodies against Neisseria m...

    ID: 1494409

    Description: epitope description:PIQNSKSAYTPAHYTRQNNADVFVPAVVGKPGS antigen name:Major outer membrane protein P.IA host organism:Mus musculus BALB/c

    Publication: 11578688;

  21. Generation of monoclonal antibodies against human prion proteins in PrP0/0 mice.

    ID: 1494410

    Description: epitope description:RYPGQGSPGGNRYPPQG antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:mab 4F2

    Publication: 8972487;

  22. A conjugate vaccine composed of a heat shock protein 60 T-cell epitope peptide (p458) and Neisseria meningitidis type B capsular polysaccharide.

    ID: 1494413

    Description: epitope description:NEDQKIGIEIIKRALKI antigen name:60 kDa heat shock protein, mitochondrial host organism:Mus musculus BALB/c

    Publication: 16843573;

  23. Exploring computational lead optimisation with affinity constants obtained by surface plasmon resonance for the interaction of PorA epitope peptides w...

    ID: 1494434

    Description: epitope description:DTNNN antigen name:Major outer membrane protein P.IA host organism:Mus musculus antibody name:MN12H2

    Publication: 11786227;

  24. A hypoallergenic vaccine obtained by tail-to-head restructuring of timothy grass pollen profilin, Phl p 12, for the treatment of cross-sensitization t...

    ID: 1494439

    Description: epitope description:MKDFDEPGHLAPTGMFVAGAKYMVIQG antigen name:Phl p 12 host organism:Mus musculus BALB/c

    Publication: 18025208;

  25. Generation of recombinant monoclonal antibodies to study structure-function of envelope protein VP28 of white spot syndrome virus from shrimp.

    ID: 1494464

    Description: epitope description:RYHNTVTKTIETHTDNIETNMDENLRIPVTAEVGSGYFKM antigen name:Wsv421 host organism:Mus musculus BALB/c antibody name:P108D2, P111B10

    Publication: 18538134;

  26. Generation of recombinant monoclonal antibodies to study structure-function of envelope protein VP28 of white spot syndrome virus from shrimp.

    ID: 1494468

    Description: epitope description:SDAQMKE antigen name:Wsv421 host organism:Mus musculus BALB/c antibody name:P108B4

    Publication: 18538134;

  27. Generation of recombinant monoclonal antibodies to study structure-function of envelope protein VP28 of white spot syndrome virus from shrimp.

    ID: 1494469

    Description: epitope description:SDAQMKE antigen name:Wsv421 host organism:Mus musculus BALB/c antibody name:P108B4

    Publication: 18538134;

  28. Construction of hevein (Hev b 6.02) with reduced allergenicity for immunotherapy of latex allergy by comutation of six amino acid residues on the conf...

    ID: 1494479

    Description: epitope description:E29 antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 14764736;

  29. Construction of hevein (Hev b 6.02) with reduced allergenicity for immunotherapy of latex allergy by comutation of six amino acid residues on the conf...

    ID: 1494482

    Description: epitope description:Q38 antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 14764736;

  30. Mapping of the antigenic regions of streptokinase in humans after streptokinase therapy.

    ID: 1494509

    Description: epitope description:VSVAGTVEGTNQDISLKFFE antigen name:Streptokinase host organism:Homo sapiens

    Publication: 10334933;

  31. Mapping of the antigenic regions of streptokinase in humans after streptokinase therapy.

    ID: 1494512

    Description: epitope description:MPHKLEKADLLKAIQEQLIA antigen name:Streptokinase host organism:Homo sapiens

    Publication: 10334933;

  32. Selection of an immunogenic peptide mimic of the capsular polysaccharide of Neisseria meningitidis serogroup A using a peptide display library.

    ID: 1494567

    Description: epitope description:GHREAFLPPWVFXFL host organism:Mus musculus BALB/c antibody name:9C10

    Publication: 10649627;

  33. Selection of an immunogenic peptide mimic of the capsular polysaccharide of Neisseria meningitidis serogroup A using a peptide display library.

    ID: 1494568

    Description: epitope description:GNRPVRPQVYFSASS host organism:Mus musculus BALB/c antibody name:9C10

    Publication: 10649627;

  34. Selection of an immunogenic peptide mimic of the capsular polysaccharide of Neisseria meningitidis serogroup A using a peptide display library.

    ID: 1494570

    Description: epitope description:SGFVAGKGFRLDFGS host organism:Mus musculus BALB/c antibody name:9C10

    Publication: 10649627;

  35. Mapping of the antigenic regions of streptokinase in humans after streptokinase therapy.

    ID: 1494572

    Description: epitope description:QPVQEFLLSGHVRVRPYKEK antigen name:Streptokinase host organism:Homo sapiens

    Publication: 10334933;

  36. Mapping of the antigenic regions of streptokinase in humans after streptokinase therapy.

    ID: 1494573

    Description: epitope description:HVRVRPYKEKPIQNQAKSVD antigen name:Streptokinase host organism:Homo sapiens

    Publication: 10334933;

  37. Mapping of the antigenic regions of streptokinase in humans after streptokinase therapy.

    ID: 1494576

    Description: epitope description:NPDDDFRPGLKDTKLLKTLA antigen name:Streptokinase host organism:Homo sapiens

    Publication: 10334933;

  38. Mapping of the antigenic regions of streptokinase in humans after streptokinase therapy.

    ID: 1494579

    Description: epitope description:LAQAQSILNKTHPGYTIYER antigen name:Streptokinase host organism:Homo sapiens

    Publication: 10334933;

  39. Mapping of the antigenic regions of streptokinase in humans after streptokinase therapy.

    ID: 1494590

    Description: epitope description:VDVNTNELLKSEQLLTASER antigen name:Streptokinase host organism:Homo sapiens

    Publication: 10334933;

  40. Mapping of the antigenic regions of streptokinase in humans after streptokinase therapy.

    ID: 1494591

    Description: epitope description:SEQLLTASERNLDFRDLYDP antigen name:Streptokinase host organism:Homo sapiens

    Publication: 10334933;

  41. Use of bacteriophage T7 displayed peptides for determination of monoclonal antibody specificity and biosensor analysis of the binding reaction.

    ID: 1491834

    Description: epitope description:CVHPDKDSC host organism:Mus musculus BALB/c antibody name:F5

    Publication: 10075827;

  42. Use of bacteriophage T7 displayed peptides for determination of monoclonal antibody specificity and biosensor analysis of the binding reaction.

    ID: 1491840

    Description: epitope description:CDPPIDLDC host organism:Mus musculus antibody name:LT1

    Publication: 10075827;

  43. Use of bacteriophage T7 displayed peptides for determination of monoclonal antibody specificity and biosensor analysis of the binding reaction.

    ID: 1491841

    Description: epitope description:CDPQPDFSC host organism:Mus musculus antibody name:LT1

    Publication: 10075827;

  44. Proteins and their derived peptides as carriers in a conjugate vaccine for Streptococcus pneumoniae: self-heat shock protein 60 and tetanus toxoid.

    ID: 1491895

    Description: epitope description:IRAWVAWRAHCQNRD antigen name:Lysozyme C-2 host organism:Mus musculus BALB/c

    Publication: 12794147;

  45. Proteins and their derived peptides as carriers in a conjugate vaccine for Streptococcus pneumoniae: self-heat shock protein 60 and tetanus toxoid.

    ID: 1491896

    Description: epitope description:NEDQKIGIEIIKRALKI antigen name:60 kDa heat shock protein, mitochondrial host organism:Mus musculus BALB/c antibody name:anti - PS4...

    Publication: 12794147;

  46. Proteins and their derived peptides as carriers in a conjugate vaccine for Streptococcus pneumoniae: self-heat shock protein 60 and tetanus toxoid.

    ID: 1491900

    Description: epitope description:FNNFTVSFWLRVPKVSASHLE antigen name:Tetanus toxin host organism:Mus musculus BALB/c antibody name:anti - PS4 Ab

    Publication: 12794147;

  47. Analysis of multiple antigenic determinants of Clostridium perfringens enterotoxin as revealed by use of different synthetic peptides.

    ID: 1491922

    Description: epitope description:TAGPNEYVYYKVYATYRKYQ antigen name:Heat-labile enterotoxin B chain host organism:Oryctolagus cuniculus antibody name:anti-CPE

    Publication: 7535106;

  48. Analysis of multiple antigenic determinants of Clostridium perfringens enterotoxin as revealed by use of different synthetic peptides.

    ID: 1491957

    Description: epitope description:TNSNSNLSDGLYVIDKGDGG host organism:Oryctolagus cuniculus antibody name:anti-CPE

    Publication: 7535106;

  49. Analysis of multiple antigenic determinants of Clostridium perfringens enterotoxin as revealed by use of different synthetic peptides.

    ID: 1491963

    Description: epitope description:YRKYQAIRISHGNISDDGSI antigen name:Heat-labile enterotoxin B chain host organism:Oryctolagus cuniculus antibody name:anti-CPE

    Publication: 7535106;

  50. Proteins and their derived peptides as carriers in a conjugate vaccine for Streptococcus pneumoniae: self-heat shock protein 60 and tetanus toxoid.

    ID: 1491966

    Description: epitope description:LVLNRLKVGLQVVAVKAPGF antigen name:60 kDa heat shock protein, mitochondrial host organism:Mus musculus BALB/c antibody name:Ab to t...

    Publication: 12794147;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston