Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Preparation and characterization of antibodies against mouse prion protein (PrP) peptides.

    ID: 1276422

    Description: epitope description:RENMYRYPNQ antigen name:Major prion protein host organism:Oryctolagus cuniculus antibody name:Ab150-159

    Publication: 7535178;

  2. Preparation and characterization of antibodies against mouse prion protein (PrP) peptides.

    ID: 1276423

    Description: epitope description:RENMYRYPNQ antigen name:Major prion protein host organism:Oryctolagus cuniculus antibody name:Ab150-159

    Publication: 7535178;

  3. Preparation and characterization of antibodies against mouse prion protein (PrP) peptides.

    ID: 1276431

    Description: epitope description:CVTQYQKESQAYYD antigen name:Major prion protein host organism:Oryctolagus cuniculus antibody name:Ab213-226

    Publication: 7535178;

  4. Mapping of protective and cross-reactive domains of the type A neurotoxin of Clostridium botulinum.

    ID: 1276439

    Description: epitope description:EIIWTLQDTQEIKQRVVFKYSQMINISDYINRWIFVTITNNRLNNSKIYINGRLIDQKPISNLGNIHASNNIMFKLDGCRDTHRYIWIKYFNLFDKELNEKEIKDLYDNQSNSGILKDFWGDYLQYDKPY...

    Publication: 9014296;

  5. Mapping of protective and cross-reactive domains of the type A neurotoxin of Clostridium botulinum.

    ID: 1276440

    Description: epitope description:EIIWTLQDTQEIKQRVVFKYSQMINISDYINRWIFVTITNNRLNNSKIYINGRLIDQKPISNLGNIHASNNIMFKLDGCRDTHRYIWIKYFNLFDKELNEKEIKDLYDNQSNSGILKDFWGDYLQYDKPY...

    Publication: 9014296;

  6. Mapping of protective and cross-reactive domains of the type A neurotoxin of Clostridium botulinum.

    ID: 1276445

    Description: epitope description:LNSSLYRGTKFIIKKYASGNKDNIVRNNDRVYINVVVKNKEYRLATNASQAGVEKILSALEIPDVGNLSQVVVMKSKNDQGITNKCKMNLQDNNGNDIGFIGFHQFNNIAKLVASNWYNRQIERSSRTLG...

    Publication: 9014296;

  7. Definition of Brucella A and M epitopes by monoclonal typing reagents and synthetic oligosaccharides.

    ID: 1269754

    Description: epitope description:alpha-D-Rhap4NFo-(1->3)-alpha-D-Rhap4NFo-(1->2)-alpha-D-Rhap4NFo-(1->2)-alpha-D-Rhap4NFo-(1->2)-alpha-D-Rhap4NFo-yl group antigen ...

    Publication: 2474505;

  8. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1269929

    Description: epitope description:YLTETKIDKL antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  9. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1269935

    Description: epitope description:IDKLCVWNNK antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  10. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1269972

    Description: epitope description:QSITELCSEY antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston