Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Induction of an antigen-specific immune response and partial protection of cattle against challenge infection with foot-and-mouth disease virus (FMDV)...

    ID: 1466087

    Description: epitope description:GPYAGPMERQKPLK antigen name:Polyprotein host organism:Bos taurus antibody name:Bovine sera

    Publication: 14645912;

  2. Induction of an antigen-specific immune response and partial protection of cattle against challenge infection with foot-and-mouth disease virus (FMDV)...

    ID: 1466088

    Description: epitope description:GPYAGPMERQKPLK antigen name:Polyprotein host organism:Bos taurus antibody name:Bovine sera

    Publication: 14645912;

  3. Induction of an antigen-specific immune response and partial protection of cattle against challenge infection with foot-and-mouth disease virus (FMDV)...

    ID: 1466089

    Description: epitope description:GPYAGPMERQKPLK antigen name:Polyprotein host organism:Bos taurus antibody name:Bovine sera

    Publication: 14645912;

  4. Induction of an antigen-specific immune response and partial protection of cattle against challenge infection with foot-and-mouth disease virus (FMDV)...

    ID: 1466091

    Description: epitope description:PMERQKPLKVKAKA antigen name:Polyprotein host organism:Bos taurus antibody name:Bovine sera

    Publication: 14645912;

  5. Induction of an antigen-specific immune response and partial protection of cattle against challenge infection with foot-and-mouth disease virus (FMDV)...

    ID: 1466093

    Description: epitope description:PMERQKPLKVKAKA antigen name:Polyprotein host organism:Bos taurus antibody name:Bovine sera

    Publication: 14645912;

  6. Induction of an antigen-specific immune response and partial protection of cattle against challenge infection with foot-and-mouth disease virus (FMDV)...

    ID: 1466096

    Description: epitope description:PVKKPVALKVKAKN antigen name:Polyprotein host organism:Bos taurus antibody name:Bovine sera

    Publication: 14645912;

  7. Detailed mapping of the antigenicity of the surface unit glycoprotein of equine infectious anemia virus by using synthetic peptide strategies.

    ID: 1466112

    Description: epitope description:REITFIYKSSCTDSDH antigen name:envelope polyprotein host organism:Equus caballus

    Publication: 1370556;

  8. Detailed mapping of the antigenicity of the surface unit glycoprotein of equine infectious anemia virus by using synthetic peptide strategies.

    ID: 1466113

    Description: epitope description:TDSDHCQEYQCKKVNLNSSDS antigen name:envelope polyprotein host organism:Equus caballus

    Publication: 1370556;

  9. Detailed mapping of the antigenicity of the surface unit glycoprotein of equine infectious anemia virus by using synthetic peptide strategies.

    ID: 1466115

    Description: epitope description:SSDSSNSVRVEDVTNTAEYWGFKWLECNQT antigen name:envelope polyprotein host organism:Equus caballus

    Publication: 1370556;

  10. Detailed mapping of the antigenicity of the surface unit glycoprotein of equine infectious anemia virus by using synthetic peptide strategies.

    ID: 1466121

    Description: epitope description:KGCNETWARVKRCPIDILYGIHPIRLCVQ antigen name:envelope polyprotein host organism:Equus caballus

    Publication: 1370556;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston