Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Preparation and characterization of antibodies against mouse prion protein (PrP) peptides.

    ID: 1276422

    Description: epitope description:RENMYRYPNQ antigen name:Major prion protein host organism:Oryctolagus cuniculus antibody name:Ab150-159

    Publication: 7535178;

  2. Preparation and characterization of antibodies against mouse prion protein (PrP) peptides.

    ID: 1276423

    Description: epitope description:RENMYRYPNQ antigen name:Major prion protein host organism:Oryctolagus cuniculus antibody name:Ab150-159

    Publication: 7535178;

  3. Preparation and characterization of antibodies against mouse prion protein (PrP) peptides.

    ID: 1276431

    Description: epitope description:CVTQYQKESQAYYD antigen name:Major prion protein host organism:Oryctolagus cuniculus antibody name:Ab213-226

    Publication: 7535178;

  4. Mapping of protective and cross-reactive domains of the type A neurotoxin of Clostridium botulinum.

    ID: 1276439

    Description: epitope description:EIIWTLQDTQEIKQRVVFKYSQMINISDYINRWIFVTITNNRLNNSKIYINGRLIDQKPISNLGNIHASNNIMFKLDGCRDTHRYIWIKYFNLFDKELNEKEIKDLYDNQSNSGILKDFWGDYLQYDKPY...

    Publication: 9014296;

  5. Mapping of protective and cross-reactive domains of the type A neurotoxin of Clostridium botulinum.

    ID: 1276440

    Description: epitope description:EIIWTLQDTQEIKQRVVFKYSQMINISDYINRWIFVTITNNRLNNSKIYINGRLIDQKPISNLGNIHASNNIMFKLDGCRDTHRYIWIKYFNLFDKELNEKEIKDLYDNQSNSGILKDFWGDYLQYDKPY...

    Publication: 9014296;

  6. Mapping of protective and cross-reactive domains of the type A neurotoxin of Clostridium botulinum.

    ID: 1276445

    Description: epitope description:LNSSLYRGTKFIIKKYASGNKDNIVRNNDRVYINVVVKNKEYRLATNASQAGVEKILSALEIPDVGNLSQVVVMKSKNDQGITNKCKMNLQDNNGNDIGFIGFHQFNNIAKLVASNWYNRQIERSSRTLG...

    Publication: 9014296;

  7. Definition of Brucella A and M epitopes by monoclonal typing reagents and synthetic oligosaccharides.

    ID: 1269754

    Description: epitope description:alpha-D-Rhap4NFo-(1->3)-alpha-D-Rhap4NFo-(1->2)-alpha-D-Rhap4NFo-(1->2)-alpha-D-Rhap4NFo-(1->2)-alpha-D-Rhap4NFo-yl group antigen ...

    Publication: 2474505;

  8. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1269929

    Description: epitope description:YLTETKIDKL antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  9. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1269935

    Description: epitope description:IDKLCVWNNK antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  10. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1269972

    Description: epitope description:QSITELCSEY antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  11. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1269973

    Description: epitope description:SITELCSEYR antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  12. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1269976

    Description: epitope description:ELCSEYRNTQ antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  13. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1269979

    Description: epitope description:SEYRNTQIYT antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  14. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1269990

    Description: epitope description:YTINDKILSY antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  15. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270004

    Description: epitope description:ILSYTESMAG antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  16. Definition of Brucella A and M epitopes by monoclonal typing reagents and synthetic oligosaccharides.

    ID: 1269755

    Description: epitope description:alpha-D-Rhap4NFo-(1->3)-alpha-D-Rhap4NFo-(1->2)-alpha-D-Rhap4NFo-(1->2)-alpha-D-Rhap4NFo-(1->2)-alpha-D-Rhap4NFo-yl group antigen ...

    Publication: 2474505;

  17. Definition of Brucella A and M epitopes by monoclonal typing reagents and synthetic oligosaccharides.

    ID: 1269757

    Description: epitope description:alpha-D-Rhap4NFo-(1->2)-alpha-D-Rhap4NFo(1->3)-alpha-D-Rhap4NFo-yl group antigen name:lipopolysaccharide host organism:Mus musculu...

    Publication: 2474505;

  18. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1269783

    Description: epitope description:VPGSQHIDSQ antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  19. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1269873

    Description: epitope description:QKKAIERMKD antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  20. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1269880

    Description: epitope description:DTLRITYLTE antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  21. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1269883

    Description: epitope description:TLRITYLTET antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  22. Definition of Brucella A and M epitopes by monoclonal typing reagents and synthetic oligosaccharides.

    ID: 1269911

    Description: epitope description:alpha-D-Rhap4NFo-(1->2)-alpha-D-Rhap4NFo-(1->2)-alpha-D-Rhap4NFo-(1->2)-alpha-D-Rhap4NFo-(1->2)-alpha-D-Rhap4NFo-yl group antigen ...

    Publication: 2474505;

  23. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270015

    Description: epitope description:REMVIITFKS antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  24. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270021

    Description: epitope description:TFKSGATFQV antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  25. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270029

    Description: epitope description:QVEVPGSQHI antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  26. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270238

    Description: epitope description:VPGSQHIDSQ antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  27. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270242

    Description: epitope description:QHIDSQKKAI antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  28. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270247

    Description: epitope description:QKKAIERMKD antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  29. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270255

    Description: epitope description:KDTLRITYLT antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  30. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270257

    Description: epitope description:TLRITYLTET antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  31. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270261

    Description: epitope description:TYLTETKIDK antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  32. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270262

    Description: epitope description:YLTETKIDKL antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  33. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270277

    Description: epitope description:PNSIAAISME antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  34. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270278

    Description: epitope description:NSIAAISMEE antigen name:Other Escherichia coli protein host organism:Mus musculus BALB/c

    Publication: 8606092;

  35. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270284

    Description: epitope description:APQSITELCS antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  36. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270380

    Description: epitope description:QSITELCSEY antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  37. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270381

    Description: epitope description:SITELCSEYR antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  38. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270383

    Description: epitope description:TELCSEYRNT antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  39. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270384

    Description: epitope description:ELCSEYRNTQ antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  40. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270389

    Description: epitope description:QSITELCSEY antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  41. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270397

    Description: epitope description:EYRNTQIYTI antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  42. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270399

    Description: epitope description:RNTQIYTIND antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  43. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270400

    Description: epitope description:NTQIYTINDK antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  44. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270411

    Description: epitope description:TQIYTINDKI antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  45. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270413

    Description: epitope description:IYTINDKILS antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  46. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270419

    Description: epitope description:KILSYTESMA antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  47. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270426

    Description: epitope description:SMAGKREMVI antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  48. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270427

    Description: epitope description:NDKILSYTES antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  49. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270440

    Description: epitope description:KREMVIITFK antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  50. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270441

    Description: epitope description:REMVIITFKS antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  51. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270445

    Description: epitope description:IITFKSGATF antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  52. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270446

    Description: epitope description:ITFKSGATFQ antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  53. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270457

    Description: epitope description:TFKSGATFQV antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  54. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270478

    Description: epitope description:VPGSQHIDSQ antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  55. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270481

    Description: epitope description:SQHIDSQKKA antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  56. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270507

    Description: epitope description:EVPGSQHIDS antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  57. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270509

    Description: epitope description:PGSQHIDSQK antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  58. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270530

    Description: epitope description:AIERMKDTLR antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  59. Identification of a cross-reactive continuous B-cell epitope in enterotoxigenic Escherichia coli colonization factor antigen I.

    ID: 1272010

    Description: epitope description:SYRVMT antigen name:CFA/I fimbrial subunit B (UniProt:E3PPC4) host organism:Mus musculus antibody name:mAb S-CFA/I 17:8, mAb S-CFA...

    Publication: 8890199;

  60. Identification of a cross-reactive continuous B-cell epitope in enterotoxigenic Escherichia coli colonization factor antigen I.

    ID: 1272020

    Description: epitope description:LSTTAK antigen name:CFA/I fimbrial subunit B (UniProt:E3PPC4) host organism:Mus musculus antibody name:mAb S-CFA/I 17:8, mAb S-CFA...

    Publication: 8890199;

  61. Identification of a cross-reactive continuous B-cell epitope in enterotoxigenic Escherichia coli colonization factor antigen I.

    ID: 1272023

    Description: epitope description:TAKEFE antigen name:CFA/I fimbrial subunit B (UniProt:E3PPC4) host organism:Mus musculus antibody name:mAb S-CFA/I 17:8, mAb S-CFA...

    Publication: 8890199;

  62. Identification of a cross-reactive continuous B-cell epitope in enterotoxigenic Escherichia coli colonization factor antigen I.

    ID: 1272028

    Description: epitope description:EAAALG antigen name:CFA/I fimbrial subunit B (UniProt:E3PPC4) host organism:Mus musculus antibody name:mAb S-CFA/I 17:8, mAb S-CFA...

    Publication: 8890199;

  63. Identification of a cross-reactive continuous B-cell epitope in enterotoxigenic Escherichia coli colonization factor antigen I.

    ID: 1272037

    Description: epitope description:SGVNGV antigen name:CFA/I fimbrial subunit B (UniProt:E3PPC4) host organism:Mus musculus antibody name:mAb S-CFA/I 17:8, mAb S-CFA...

    Publication: 8890199;

  64. Identification of a cross-reactive continuous B-cell epitope in enterotoxigenic Escherichia coli colonization factor antigen I.

    ID: 1272039

    Description: epitope description:VNGVSS antigen name:CFA/I fimbrial subunit B (UniProt:E3PPC4) host organism:Mus musculus antibody name:mAb S-CFA/I 17:8, mAb S-CFA...

    Publication: 8890199;

  65. Identification of a cross-reactive continuous B-cell epitope in enterotoxigenic Escherichia coli colonization factor antigen I.

    ID: 1272041

    Description: epitope description:AAPKTA antigen name:CFA/I fimbrial subunit B (UniProt:E3PPC4) host organism:Mus musculus antibody name:mAb S-CFA/I 17:8, mAb S-CFA...

    Publication: 8890199;

  66. Identification of a cross-reactive continuous B-cell epitope in enterotoxigenic Escherichia coli colonization factor antigen I.

    ID: 1272054

    Description: epitope description:NYSGVV antigen name:CFA/I fimbrial subunit B (UniProt:E3PPC4) host organism:Mus musculus antibody name:mAb S-CFA/I 17:8, mAb S-CFA...

    Publication: 8890199;

  67. Identification of a cross-reactive continuous B-cell epitope in enterotoxigenic Escherichia coli colonization factor antigen I.

    ID: 1272062

    Description: epitope description:VMTLGS antigen name:CFA/I fimbrial subunit B (UniProt:E3PPC4) host organism:Mus musculus antibody name:mAb S-CFA/I 17:8, mAb S-CFA...

    Publication: 8890199;

  68. Identification of a cross-reactive continuous B-cell epitope in enterotoxigenic Escherichia coli colonization factor antigen I.

    ID: 1272066

    Description: epitope description:NITVTA antigen name:CFA/I fimbrial subunit B (UniProt:E3PPC4) host organism:Oryctolagus cuniculus

    Publication: 8890199;

  69. Identification of a cross-reactive continuous B-cell epitope in enterotoxigenic Escherichia coli colonization factor antigen I.

    ID: 1272079

    Description: epitope description:LLQADG antigen name:CFA/I fimbrial subunit B (UniProt:E3PPC4) host organism:Oryctolagus cuniculus

    Publication: 8890199;

  70. Identification of a cross-reactive continuous B-cell epitope in enterotoxigenic Escherichia coli colonization factor antigen I.

    ID: 1272085

    Description: epitope description:NALPSA antigen name:CFA/I fimbrial subunit B (UniProt:E3PPC4) host organism:Oryctolagus cuniculus

    Publication: 8890199;

  71. Identification of a cross-reactive continuous B-cell epitope in enterotoxigenic Escherichia coli colonization factor antigen I.

    ID: 1272089

    Description: epitope description:SAVKLA antigen name:CFA/I fimbrial subunit B (UniProt:E3PPC4) host organism:Oryctolagus cuniculus

    Publication: 8890199;

  72. Identification of a cross-reactive continuous B-cell epitope in enterotoxigenic Escherichia coli colonization factor antigen I.

    ID: 1272094

    Description: epitope description:AYSPAS antigen name:CFA/I fimbrial subunit B (UniProt:E3PPC4) host organism:Oryctolagus cuniculus

    Publication: 8890199;

  73. Identification of a cross-reactive continuous B-cell epitope in enterotoxigenic Escherichia coli colonization factor antigen I.

    ID: 1272096

    Description: epitope description:SPASKT antigen name:CFA/I fimbrial subunit B (UniProt:E3PPC4) host organism:Oryctolagus cuniculus

    Publication: 8890199;

  74. Identification of a cross-reactive continuous B-cell epitope in enterotoxigenic Escherichia coli colonization factor antigen I.

    ID: 1272108

    Description: epitope description:MTQVHT antigen name:CFA/I fimbrial subunit B (UniProt:E3PPC4) host organism:Oryctolagus cuniculus

    Publication: 8890199;

  75. Identification of a cross-reactive continuous B-cell epitope in enterotoxigenic Escherichia coli colonization factor antigen I.

    ID: 1272112

    Description: epitope description:QVLSTT antigen name:CFA/I fimbrial subunit B (UniProt:E3PPC4) host organism:Oryctolagus cuniculus

    Publication: 8890199;

  76. Identification of a cross-reactive continuous B-cell epitope in enterotoxigenic Escherichia coli colonization factor antigen I.

    ID: 1272113

    Description: epitope description:VLSTTA antigen name:CFA/I fimbrial subunit B (UniProt:E3PPC4) host organism:Oryctolagus cuniculus

    Publication: 8890199;

  77. Identification of a cross-reactive continuous B-cell epitope in enterotoxigenic Escherichia coli colonization factor antigen I.

    ID: 1272126

    Description: epitope description:LGYSAS antigen name:CFA/I fimbrial subunit B (UniProt:E3PPC4) host organism:Oryctolagus cuniculus

    Publication: 8890199;

  78. Identification of a cross-reactive continuous B-cell epitope in enterotoxigenic Escherichia coli colonization factor antigen I.

    ID: 1272130

    Description: epitope description:ASGVNG antigen name:CFA/I fimbrial subunit B (UniProt:E3PPC4) host organism:Oryctolagus cuniculus

    Publication: 8890199;

  79. Identification of a cross-reactive continuous B-cell epitope in enterotoxigenic Escherichia coli colonization factor antigen I.

    ID: 1272134

    Description: epitope description:NGVSSS antigen name:CFA/I fimbrial subunit B (UniProt:E3PPC4) host organism:Oryctolagus cuniculus

    Publication: 8890199;

  80. Identification of a cross-reactive continuous B-cell epitope in enterotoxigenic Escherichia coli colonization factor antigen I.

    ID: 1272138

    Description: epitope description:KTAGTA antigen name:CFA/I fimbrial subunit B (UniProt:E3PPC4) host organism:Oryctolagus cuniculus

    Publication: 8890199;

  81. Identification of a cross-reactive continuous B-cell epitope in enterotoxigenic Escherichia coli colonization factor antigen I.

    ID: 1272142

    Description: epitope description:TAPTAG antigen name:CFA/I fimbrial subunit B (UniProt:E3PPC4) host organism:Oryctolagus cuniculus

    Publication: 8890199;

  82. Identification of a cross-reactive continuous B-cell epitope in enterotoxigenic Escherichia coli colonization factor antigen I.

    ID: 1272143

    Description: epitope description:APTAGN antigen name:CFA/I fimbrial subunit B (UniProt:E3PPC4) host organism:Oryctolagus cuniculus

    Publication: 8890199;

  83. Identification of a cross-reactive continuous B-cell epitope in enterotoxigenic Escherichia coli colonization factor antigen I.

    ID: 1272147

    Description: epitope description:GNYSGV antigen name:CFA/I fimbrial subunit B (UniProt:E3PPC4) host organism:Oryctolagus cuniculus

    Publication: 8890199;

  84. Identification of a cross-reactive continuous B-cell epitope in enterotoxigenic Escherichia coli colonization factor antigen I.

    ID: 1272154

    Description: epitope description:SLVMTL antigen name:CFA/I fimbrial subunit B (UniProt:E3PPC4) host organism:Oryctolagus cuniculus

    Publication: 8890199;

  85. Identification of a cross-reactive continuous B-cell epitope in enterotoxigenic Escherichia coli colonization factor antigen I.

    ID: 1272161

    Description: epitope description:NITVTA antigen name:CFA/I fimbrial subunit B (UniProt:E3PPC4) host organism:Oryctolagus cuniculus

    Publication: 8890199;

  86. Identification of a cross-reactive continuous B-cell epitope in enterotoxigenic Escherichia coli colonization factor antigen I.

    ID: 1272163

    Description: epitope description:TVTASV antigen name:CFA/I fimbrial subunit B (UniProt:E3PPC4) host organism:Oryctolagus cuniculus

    Publication: 8890199;

  87. Identification of a cross-reactive continuous B-cell epitope in enterotoxigenic Escherichia coli colonization factor antigen I.

    ID: 1272164

    Description: epitope description:VTASVD antigen name:CFA/I fimbrial subunit B (UniProt:E3PPC4) host organism:Oryctolagus cuniculus

    Publication: 8890199;

  88. Identification of a cross-reactive continuous B-cell epitope in enterotoxigenic Escherichia coli colonization factor antigen I.

    ID: 1272168

    Description: epitope description:VDPVID antigen name:CFA/I fimbrial subunit B (UniProt:E3PPC4) host organism:Oryctolagus cuniculus

    Publication: 8890199;

  89. Identification of a cross-reactive continuous B-cell epitope in enterotoxigenic Escherichia coli colonization factor antigen I.

    ID: 1272171

    Description: epitope description:VIDLLQ antigen name:CFA/I fimbrial subunit B (UniProt:E3PPC4) host organism:Oryctolagus cuniculus

    Publication: 8890199;

  90. Characterization of five Shigella flexneri variant Y-specific monoclonal antibodies using defined saccharides and glycoconjugate antigens.

    ID: 1272208

    Description: epitope description:alpha-L-Rhap-(1->3)-beta-D-GlcpNAc-(1->2)-alpha-L-Rhap-(1->2)-alpha-L-Rhap antigen name:lipopolysaccharide host organism:Rattus no...

    Publication: 2438343;

  91. Characterization of five Shigella flexneri variant Y-specific monoclonal antibodies using defined saccharides and glycoconjugate antigens.

    ID: 1272216

    Description: epitope description:alpha-L-Rhap-(1->2)-L-Rhap antigen name:lipopolysaccharide host organism:Mus musculus BALB/c antibody name:MASF Y-3, MASF Y-4

    Publication: 2438343;

  92. Linear epitopes of colonization factor antigen I and peptide vaccine approach to enterotoxigenic Escherichia coli.

    ID: 1272274

    Description: epitope description:PQLTDVLN antigen name:CFA/I fimbrial subunit B (UniProt:E3PPC4) host organism:Macaca mulatta

    Publication: 9281854;

  93. Linear epitopes of colonization factor antigen I and peptide vaccine approach to enterotoxigenic Escherichia coli.

    ID: 1272276

    Description: epitope description:GTAPT antigen name:CFA/I fimbrial subunit B (UniProt:E3PPC4) host organism:Macaca mulatta

    Publication: 9281854;

  94. Linear epitopes of colonization factor antigen I and peptide vaccine approach to enterotoxigenic Escherichia coli.

    ID: 1272277

    Description: epitope description:KNITVTASV antigen name:CFA/I fimbrial subunit B (UniProt:E3PPC4) host organism:Macaca mulatta

    Publication: 9281854;

  95. Epitope-mapping studies define two major neutralization sites on the vaccinia virus extracellular enveloped virus glycoprotein B5R.

    ID: 1272296

    Description: epitope description:KWKYENPCKKMCTVSDYISE antigen name:Plaque-size/host range protein host organism:Mus musculus antibody name:VMC-21, VMC-22, VMC-19

    Publication: 15858010;

  96. Mucosal immunization with surface-displayed severe acute respiratory syndrome coronavirus spike protein on Lactobacillus casei induces neutralizing an...

    ID: 1272915

    Description: epitope description:KSFEIDKGIYQTSNFRVV antigen name:Spike glycoprotein host organism:Mus musculus C57BL/6

    Publication: 16571824;

  97. Mucosal immunization with surface-displayed severe acute respiratory syndrome coronavirus spike protein on Lactobacillus casei induces neutralizing an...

    ID: 1272919

    Description: epitope description:TNLCPFGEVFNATKFPSV antigen name:Spike glycoprotein host organism:Mus musculus C57BL/6

    Publication: 16571824;

  98. Mucosal immunization with surface-displayed severe acute respiratory syndrome coronavirus spike protein on Lactobacillus casei induces neutralizing an...

    ID: 1272923

    Description: epitope description:DYSVLYNSTFFSTFKCY antigen name:Spike glycoprotein host organism:Mus musculus C57BL/6

    Publication: 16571824;

  99. Mucosal immunization with surface-displayed severe acute respiratory syndrome coronavirus spike protein on Lactobacillus casei induces neutralizing an...

    ID: 1272924

    Description: epitope description:STFFSTFKCYGVSATKL antigen name:Spike glycoprotein host organism:Mus musculus C57BL/6

    Publication: 16571824;

  100. Mucosal immunization with surface-displayed severe acute respiratory syndrome coronavirus spike protein on Lactobacillus casei induces neutralizing an...

    ID: 1272931

    Description: epitope description:KLPDDFMGCVLAWNTRNI antigen name:Spike glycoprotein host organism:Mus musculus C57BL/6

    Publication: 16571824;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston