Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Analysis of multiple antigenic determinants of Clostridium perfringens enterotoxin as revealed by use of different synthetic peptides.

    ID: 1491969

    Description: epitope description:MLSNNLNPMVFENAKEVFLI antigen name:Heat-labile enterotoxin B chain host organism:Oryctolagus cuniculus antibody name:anti-CPE

    Publication: 7535106;

  2. Analysis of multiple antigenic determinants of Clostridium perfringens enterotoxin as revealed by use of different synthetic peptides.

    ID: 1491972

    Description: epitope description:EKEILDLAAATERLNLTDAL antigen name:Heat-labile enterotoxin B chain host organism:Oryctolagus cuniculus antibody name:anti-CPE

    Publication: 7535106;

  3. Analysis of multiple antigenic determinants of Clostridium perfringens enterotoxin as revealed by use of different synthetic peptides.

    ID: 1491973

    Description: epitope description:WRSSNSYPWTQKLNLHLTIT antigen name:Heat-labile enterotoxin B chain host organism:Oryctolagus cuniculus antibody name:anti-CPE

    Publication: 7535106;

  4. Analysis of multiple antigenic determinants of Clostridium perfringens enterotoxin as revealed by use of different synthetic peptides.

    ID: 1491976

    Description: epitope description:KGDGWILGEPSVVSSQILNL host organism:Oryctolagus cuniculus antibody name:anti-CPE

    Publication: 7535106;

  5. Analysis of multiple antigenic determinants of Clostridium perfringens enterotoxin as revealed by use of different synthetic peptides.

    ID: 1491978

    Description: epitope description:FTSEFIQASVEYGFGITIGG host organism:Oryctolagus cuniculus antibody name:anti-CPE

    Publication: 7535106;

  6. Analysis of multiple antigenic determinants of Clostridium perfringens enterotoxin as revealed by use of different synthetic peptides.

    ID: 1491984

    Description: epitope description:SKIVDFNIYSNNFNNLVKLL host organism:Oryctolagus cuniculus antibody name:anti-CPE

    Publication: 7535106;

  7. Analysis of multiple antigenic determinants of Clostridium perfringens enterotoxin as revealed by use of different synthetic peptides.

    ID: 1491988

    Description: epitope description:EVFLISEDLKTPINITNSNS antigen name:Heat-labile enterotoxin B chain host organism:Oryctolagus cuniculus albino

    Publication: 7535106;

  8. Antibody recognition of a flexible epitope at the DNA binding site of the human papillomavirus transcriptional regulator E2.

    ID: 1492012

    Description: epitope description:N296, Y303, K327 antigen name:Regulatory protein E2 host organism:Mus musculus BALB/c antibody name:ED15

    Publication: 17176073;

  9. Antibody recognition of a flexible epitope at the DNA binding site of the human papillomavirus transcriptional regulator E2.

    ID: 1492013

    Description: epitope description:N296, Y303, K327 antigen name:Regulatory protein E2 host organism:Mus musculus BALB/c antibody name:ED15

    Publication: 17176073;

  10. Antibody recognition of a flexible epitope at the DNA binding site of the human papillomavirus transcriptional regulator E2.

    ID: 1492018

    Description: epitope description:KIPKTITVST antigen name:Regulatory protein E2 host organism:Mus musculus BALB/c antibody name:ED23

    Publication: 17176073;

  11. Analysis of multiple antigenic determinants of Clostridium perfringens enterotoxin as revealed by use of different synthetic peptides.

    ID: 1492031

    Description: epitope description:KGDGWILGEPSVVSSQILNL host organism:Oryctolagus cuniculus

    Publication: 7535106;

  12. Location of amino acid residues important for the structure and biological function of the haemagglutinin-neuraminidase glycoprotein of Sendai virus b...

    ID: 1492047

    Description: epitope description:R279 antigen name:Hemagglutinin-neuraminidase host organism:Mus musculus BALB/c antibody name:57, 66, 380, 42

    Publication: 1849969;

  13. Diversity of intrathecal antibody synthesis against HTLV-I and its relation to HTLV-I associated myelopathy.

    ID: 1492056

    Description: epitope description:PVMHPHGAPPNHRPWQMKDLQAIKQEVSQA antigen name:Gag-Pro-Pol polyprotein host organism:Homo sapiens antibody name:cerebrospinal fluid

    Publication: 8741079;

  14. Diversity of intrathecal antibody synthesis against HTLV-I and its relation to HTLV-I associated myelopathy.

    ID: 1492060

    Description: epitope description:LDLLFWEQGGLCKALQEQCRFP antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens antibody name:cerebrospinal fluid

    Publication: 8741079;

  15. Diversity of intrathecal antibody synthesis against HTLV-I and its relation to HTLV-I associated myelopathy.

    ID: 1492063

    Description: epitope description:GDYSPSCCTLTIGVSSYHSKPGNPAQPVCS antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens antibody name:cerebrospinal flui...

    Publication: 8741079;

  16. Diversity of intrathecal antibody synthesis against HTLV-I and its relation to HTLV-I associated myelopathy.

    ID: 1492075

    Description: epitope description:STWHVLYSPNVSVPSSSSTP antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens antibody name:cerebrospinal fluid

    Publication: 8741079;

  17. Location of amino acid residues important for the structure and biological function of the haemagglutinin-neuraminidase glycoprotein of Sendai virus b...

    ID: 1492077

    Description: epitope description:R279, K461 antigen name:Hemagglutinin-neuraminidase host organism:Mus musculus BALB/c antibody name:63, 50

    Publication: 1849969;

  18. Location of amino acid residues important for the structure and biological function of the haemagglutinin-neuraminidase glycoprotein of Sendai virus b...

    ID: 1492081

    Description: epitope description:P451 antigen name:Hemagglutinin-neuraminidase host organism:Mus musculus BALB/c antibody name:37

    Publication: 1849969;

  19. Diversity of intrathecal antibody synthesis against HTLV-I and its relation to HTLV-I associated myelopathy.

    ID: 1492084

    Description: epitope description:CFDPQIQAIVSSPCHN antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens antibody name:cerebrospinal fluid

    Publication: 8741079;

  20. Location of amino acid residues important for the structure and biological function of the haemagglutinin-neuraminidase glycoprotein of Sendai virus b...

    ID: 1492086

    Description: epitope description:S184 antigen name:Hemagglutinin-neuraminidase host organism:Mus musculus BALB/c antibody name:68, 41

    Publication: 1849969;

  21. Identification of adenovirus (ad) penton base neutralizing epitopes by use of sera from patients who had received conditionally replicative ad (addl15...

    ID: 1492107

    Description: epitope description:LGLDPG host organism:Homo sapiens

    Publication: 12970421;

  22. Identification of adenovirus (ad) penton base neutralizing epitopes by use of sera from patients who had received conditionally replicative ad (addl15...

    ID: 1492113

    Description: epitope description:RGDVTF host organism:Homo sapiens

    Publication: 12970421;

  23. Identification of adenovirus (ad) penton base neutralizing epitopes by use of sera from patients who had received conditionally replicative ad (addl15...

    ID: 1492118

    Description: epitope description:RNLFVD host organism:Homo sapiens

    Publication: 12970421;

  24. Monoclonal antibodies neutralizing the toxin II from Androctonus australis hector scorpion venom: usefulness of a synthetic, non-toxic analog.

    ID: 1492122

    Description: epitope description:NEECTKLKGESGYCQ antigen name:Alpha-mammal toxin AaH2 host organism:Mus musculus BALB/c antibody name:37D3

    Publication: 9276446;

  25. Monoclonal antibodies neutralizing the toxin II from Androctonus australis hector scorpion venom: usefulness of a synthetic, non-toxic analog.

    ID: 1492123

    Description: epitope description:NEECTKLKGESGYCQ antigen name:Alpha-mammal toxin AaH2 host organism:Mus musculus BALB/c antibody name:37D3

    Publication: 9276446;

  26. Identification of adenovirus (ad) penton base neutralizing epitopes by use of sera from patients who had received conditionally replicative ad (addl15...

    ID: 1492127

    Description: epitope description:PHVRGS host organism:Homo sapiens

    Publication: 12970421;

  27. The latex allergen hev B 5 is an antigen with repetitive murine B-cell epitopes.

    ID: 1492131

    Description: epitope description:APETEK antigen name:Hev b 5 host organism:Mus musculus BALB/c antibody name:3G3, 6A10, 6F6

    Publication: 15241001;

  28. Identification of adenovirus (ad) penton base neutralizing epitopes by use of sera from patients who had received conditionally replicative ad (addl15...

    ID: 1492137

    Description: epitope description:FIYLDD host organism:Homo sapiens

    Publication: 12970421;

  29. Identification of adenovirus (ad) penton base neutralizing epitopes by use of sera from patients who had received conditionally replicative ad (addl15...

    ID: 1492139

    Description: epitope description:ASFDRS host organism:Homo sapiens

    Publication: 12970421;

  30. Identification of adenovirus (ad) penton base neutralizing epitopes by use of sera from patients who had received conditionally replicative ad (addl15...

    ID: 1492142

    Description: epitope description:DRRWHR host organism:Homo sapiens

    Publication: 12970421;

  31. Identification of adenovirus (ad) penton base neutralizing epitopes by use of sera from patients who had received conditionally replicative ad (addl15...

    ID: 1492153

    Description: epitope description:RYGWYL host organism:Homo sapiens

    Publication: 12970421;

  32. Epitope specificity of monoclonal antibodies to the N-protein of porcine reproductive and respiratory syndrome virus determined by ELISA with syntheti...

    ID: 1492165

    Description: epitope description:VNQLCQLLGAMIKSQRQQPRGGQAKKKK antigen name:Nucleoprotein host organism:Mus musculus antibody name:SDOW17, VO17, NS99, 5H2:3B12, 2D6...

    Publication: 15661331;

  33. Structural basis for the binding of the neutralizing antibody, 7D11, to the poxvirus L1 protein.

    ID: 1492169

    Description: epitope description:N27, Q31, T32, K33, D35, S58, A59, D60, A61, D62, K125, K127 antigen name:Protein L1 host organism:Mus musculus antibody name:7D11

    Publication: 17688903;

  34. Location of the major antigenic sites involved in rotavirus serotype-specific neutralization.

    ID: 1492226

    Description: epitope description:K223 antigen name:Outer capsid glycoprotein VP7 host organism:Mus musculus antibody name:A11/M9

    Publication: 2422651;

  35. Location of the major antigenic sites involved in rotavirus serotype-specific neutralization.

    ID: 1492233

    Description: epitope description:T147 antigen name:Outer capsid glycoprotein VP7 host organism:Mus musculus BALB/c antibody name:RV-3:2

    Publication: 2422651;

  36. Immune recognition of the 60kD heat shock protein: implications for subsequent fertility.

    ID: 1492260

    Description: epitope description:DVVDGMNFNRGY antigen name:60 kDa chaperonin host organism:Homo sapiens

    Publication: 18476087;

  37. Immune recognition of the 60kD heat shock protein: implications for subsequent fertility.

    ID: 1492266

    Description: epitope description:SAPLKQIAANAG antigen name:60 kDa chaperonin host organism:Homo sapiens

    Publication: 18476087;

  38. Toward the assessment of food toxicity for celiac patients: characterization of monoclonal antibodies to a main immunogenic gluten peptide.

    ID: 1492274

    Description: epitope description:QPQLPY antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Mus musculus antibody name:G12

    Publication: 18509534;

  39. Structural insights into the antigenicity of myelin oligodendrocyte glycoprotein.

    ID: 1492301

    Description: epitope description:G28, Q29, K57, T60, G61, Y67, S72, R79, N80, G81, R128, D129, H130, S131, Y132, Q133, E134, E135 antigen name:Myelin-oligodendrocy...

    Publication: 12874380;

  40. A synthetic peptide corresponding to the cleavage region of VP3 from rotavirus SA11 induces neutralizing antibodies.

    ID: 1492323

    Description: epitope description:QNTRNIVPVSIVSR antigen name:Outer capsid protein VP4 host organism:Oryctolagus cuniculus

    Publication: 2845138;

  41. Epitope mapping of a protective monoclonal antibody against Pneumocystis carinii with shared reactivity to Streptococcus pneumoniae surface antigen Ps...

    ID: 1492335

    Description: epitope description:RPAPPKPTPQP antigen name:Kexin-like protease host organism:Mus musculus SCID (NOD.CB17-Prkdcscid) antibody name:4F11(G1...

    Publication: 14977961;

  42. Epitope mapping of a protective monoclonal antibody against Pneumocystis carinii with shared reactivity to Streptococcus pneumoniae surface antigen Ps...

    ID: 1492339

    Description: epitope description:RPAPPKPTPQP antigen name:Kexin-like protease host organism:Mus musculus SCID (NOD.CB17-Prkdcscid) antibody name:4F11

    Publication: 14977961;

  43. Analysis of sequential immunoglobulin E-binding epitope of Japanese cedar pollen allergen (Cry j 2) in humans, monkeys and mice.

    ID: 1492350

    Description: epitope description:RKVEHSRHDAINIFNVEKYG antigen name:Cry j 2 host organism:Mus musculus BDF1

    Publication: 12580914;

  44. Analysis of sequential immunoglobulin E-binding epitope of Japanese cedar pollen allergen (Cry j 2) in humans, monkeys and mice.

    ID: 1492360

    Description: epitope description:CKKPSAMLLVPGNKKFVVNN antigen name:Cry j 2 host organism:Homo sapiens

    Publication: 12580914;

  45. Analysis of sequential immunoglobulin E-binding epitope of Japanese cedar pollen allergen (Cry j 2) in humans, monkeys and mice.

    ID: 1492365

    Description: epitope description:PGNKKFVVNNLFFNGPCQPH antigen name:Cry j 2 host organism:Mus musculus BDF1

    Publication: 12580914;

  46. Analysis of sequential immunoglobulin E-binding epitope of Japanese cedar pollen allergen (Cry j 2) in humans, monkeys and mice.

    ID: 1492376

    Description: epitope description:NRIWLQFAKLTGFTLMGKGV antigen name:Cry j 2 host organism:Macaca fuscata

    Publication: 12580914;

  47. Analysis of sequential immunoglobulin E-binding epitope of Japanese cedar pollen allergen (Cry j 2) in humans, monkeys and mice.

    ID: 1492380

    Description: epitope description:TGFTLMGKGVIDGQGKQWWA antigen name:Cry j 2 host organism:Mus musculus BDF1

    Publication: 12580914;

  48. Analysis of sequential immunoglobulin E-binding epitope of Japanese cedar pollen allergen (Cry j 2) in humans, monkeys and mice.

    ID: 1492391

    Description: epitope description:GQCKWVNGREICNDRDRPTA antigen name:Cry j 2 host organism:Macaca fuscata

    Publication: 12580914;

  49. Analysis of sequential immunoglobulin E-binding epitope of Japanese cedar pollen allergen (Cry j 2) in humans, monkeys and mice.

    ID: 1492394

    Description: epitope description:ICNDRDRPTAIKFDFSTGLI antigen name:Cry j 2 host organism:Macaca fuscata

    Publication: 12580914;

  50. Analysis of sequential immunoglobulin E-binding epitope of Japanese cedar pollen allergen (Cry j 2) in humans, monkeys and mice.

    ID: 1492395

    Description: epitope description:ICNDRDRPTAIKFDFSTGLI antigen name:Cry j 2 host organism:Mus musculus BDF1

    Publication: 12580914;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston