Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Identification of B-cell epitopes in the capsid protein of avian hepatitis E virus (avian HEV) that are common to human and swine HEVs or unique to av...

    ID: 1277995

    Description: epitope description:VDASSGSNRFAALPAF antigen name:Capsid protein host organism:Sus scrofa

    Publication: 16361434;

  2. Cloning, expression and evaluation of a recombinant sub-unit vaccine against Clostridium botulinum type F toxin.

    ID: 1278003

    Description: epitope description:SYTNDKILILYFNKLYKKIKDNSILDMRYENNKFIDISGYGSNISINGDVYIYSTNRNQFGIYSSKPSEVNIAQNNDIIYNGRYQNFSISFWVRIPKYFNKVNLNNEYTIIDCIRNNNSGWKISLNYNKI...

    Publication: 10930684;

  3. Antigenic characterization of an abnormal isoform of prion protein using a new diverse panel of monoclonal antibodies.

    ID: 1278026

    Description: epitope description:WGQPHGGGWGQPHGGSWGQPHGGSWGQPHGGGWGQ antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:mAbs 110

    Publication: 15003861;

  4. Antigenic characterization of an abnormal isoform of prion protein using a new diverse panel of monoclonal antibodies.

    ID: 1278029

    Description: epitope description:AVVGGLGGY antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:MAb 132

    Publication: 15003861;

  5. Antigenic characterization of an abnormal isoform of prion protein using a new diverse panel of monoclonal antibodies.

    ID: 1278031

    Description: epitope description:MIHFGND antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:Mab 118

    Publication: 15003861;

  6. Mapping and characterization of B cell linear epitopes in the conservative regions of hepatitis C virus envelope glycoproteins.

    ID: 1278050

    Description: epitope description:HINRTALN antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 12010504;

  7. Antigenic structure of Clostridium botulinum type B neurotoxin and its interaction with gangliosides, cerebroside, and free fatty acids.

    ID: 1278069

    Description: epitope description:APGICIDVDNEDLFFIADKNSFSDDLSKNERIEYNTQSNYIENDFPINELILDTDLISKIELPSENTESLTDFNVDVPVYEKQPAIKKIFTDENTIFQYLYSQTFPLDIRDISLTSSFDDALLFSNKVYS...

    Publication: 2824382;

  8. Multi-well ELISA based on independent peptide antigens for antibody capture. Application to Lyme disease serodiagnosis.

    ID: 1278077

    Description: epitope description:ALIACKQNVSSL antigen name:Outer surface protein A host organism:Homo sapiens

    Publication: 8914594;

  9. Multi-well ELISA based on independent peptide antigens for antibody capture. Application to Lyme disease serodiagnosis.

    ID: 1278085

    Description: epitope description:EKNKDGKYDLIA antigen name:Outer surface protein A host organism:Homo sapiens

    Publication: 8914594;

  10. Multi-well ELISA based on independent peptide antigens for antibody capture. Application to Lyme disease serodiagnosis.

    ID: 1278087

    Description: epitope description:DLIATVDKLELK antigen name:Outer surface protein A host organism:Homo sapiens

    Publication: 8914594;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston