Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Identification of hepatitis C virus 1b-derived peptides recognized by both cellular and humoral immune systems in HCV1b(+) HLA-A24(+) patients.

    ID: 1286477

    Description: epitope description:QFKQKAIGL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 16095964;

  2. Identification of hepatitis C virus 1b-derived peptides recognized by both cellular and humoral immune systems in HCV1b(+) HLA-A24(+) patients.

    ID: 1286639

    Description: epitope description:PYIEQGMQL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 16095964;

  3. Isolation and characterization of monoclonal antibodies that inhibit hepatitis C virus NS3 protease.

    ID: 1288864

    Description: epitope description:DQDLV antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:8D4

    Publication: 10864639;

  4. Molecular specificities of antibodies against ovine and murine recombinant prion proteins.

    ID: 1288967

    Description: epitope description:THSQWNKPSKPKTNMK antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:8G8

    Publication: 11178966;

  5. Molecular specificities of antibodies against ovine and murine recombinant prion proteins.

    ID: 1288970

    Description: epitope description:GSDYEDRYYRENMHRYPNQ antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:12F10

    Publication: 11178966;

  6. Molecular specificities of antibodies against ovine and murine recombinant prion proteins.

    ID: 1288972

    Description: epitope description:CITQYERESQAYYQRGS antigen name:Major prion protein host organism:Mus musculus Biozzi antibody name:Pri 917

    Publication: 11178966;

  7. A monoclonal antibody to Bacillus anthracis protective antigen defines a neutralizing epitope in domain 1.

    ID: 1289281

    Description: epitope description:EVKQENRLLNESESSSQGLLGYYFSDLNFQAPMVVTSSTTGDLSIPSSELENIPSENQYFQSAIWSGFIKVKKSDEYTFATSADNHVTMWVDDQEVINKASNSNKIRLEKGRLYQIKIQYQRENPTEKGL...

    Publication: 16790789;

  8. Molecular specificities of antibodies against ovine and murine recombinant prion proteins.

    ID: 1289286

    Description: epitope description:THGQWNKPSKPKTNMK antigen name:Major prion protein host organism:Oryctolagus cuniculus antibody name:RB1

    Publication: 11178966;

  9. Molecular specificities of antibodies against ovine and murine recombinant prion proteins.

    ID: 1289289

    Description: epitope description:THNQWNKPSKPKTNLK antigen name:Major prion protein host organism:Oryctolagus cuniculus antibody name:RM1

    Publication: 11178966;

  10. Molecular specificities of antibodies against ovine and murine recombinant prion proteins.

    ID: 1289298

    Description: epitope description:GGWGQPHGGGWGQG antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:SAF 15

    Publication: 11178966;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston