Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Mapping of serotype-specific, immunodominant epitopes in the NS-4 region of hepatitis C virus (HCV): use of type-specific peptides to serologically di...

    ID: 1289311

    Description: epitope description:SGKPAIIPD antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7686182;

  2. Mapping of serotype-specific, immunodominant epitopes in the NS-4 region of hepatitis C virus (HCV): use of type-specific peptides to serologically di...

    ID: 1289319

    Description: epitope description:DREVLYREF antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7686182;

  3. Mapping of serotype-specific, immunodominant epitopes in the NS-4 region of hepatitis C virus (HCV): use of type-specific peptides to serologically di...

    ID: 1289325

    Description: epitope description:REFDEMEEC antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7686182;

  4. Mapping of serotype-specific, immunodominant epitopes in the NS-4 region of hepatitis C virus (HCV): use of type-specific peptides to serologically di...

    ID: 1289326

    Description: epitope description:EFDEMEECS antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7686182;

  5. Mapping of serotype-specific, immunodominant epitopes in the NS-4 region of hepatitis C virus (HCV): use of type-specific peptides to serologically di...

    ID: 1289328

    Description: epitope description:DEMEECSQH antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7686182;

  6. Mapping of serotype-specific, immunodominant epitopes in the NS-4 region of hepatitis C virus (HCV): use of type-specific peptides to serologically di...

    ID: 1289333

    Description: epitope description:ECSQHLPYI antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7686182;

  7. Mapping of protective and cross-reactive domains of the type A neurotoxin of Clostridium botulinum.

    ID: 1276448

    Description: epitope description:LNSSLYRGTKFIIKKYASGNKDNIVRNNDRVYINVVVKNKEYRLATNASQAGVEKILSALEIPDVGNLSQVVVMKSKNDQGITNKCKMNLQDNNGNDIGFIGFHQFNNIAKLVASNWYNRQIERSSRTLG...

    Publication: 9014296;

  8. Selective and efficient immunoprecipitation of the disease-associated form of the prion protein can be mediated by nonspecific interactions between mo...

    ID: 1276466

    Description: epitope description:HMAGAAAA antigen name:Major prion protein host organism:Mus musculus Biozzi antibody name:Pri-308

    Publication: 15140886;

  9. Selective and efficient immunoprecipitation of the disease-associated form of the prion protein can be mediated by nonspecific interactions between mo...

    ID: 1276467

    Description: epitope description:TQYERE antigen name:Major prion protein host organism:Mus musculus Biozzi antibody name:Pri-917

    Publication: 15140886;

  10. Selective and efficient immunoprecipitation of the disease-associated form of the prion protein can be mediated by nonspecific interactions between mo...

    ID: 1276468

    Description: epitope description:RYPNQVYYRPV antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:Bar-234

    Publication: 15140886;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston