Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Characterization of rubella virus-specific antibody responses by using a new synthetic peptide-based enzyme-linked immunosorbent assay.

    ID: 1466405

    Description: epitope description:NQQSRWGLGSPNCHGPDWASPVCQRHS antigen name:Structural polyprotein host organism:Mus musculus antibody name:12B2D, 12B3G, 13A4H, 21B9...

    Publication: 1629342;

  2. Protective and nonprotective epitopes of chemically synthesized peptides of the NH2-terminal region of type 6 streptococcal M protein.

    ID: 1466514

    Description: epitope description:RVFPRGTVENPDKARELLNK antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus New Zealand White antibody name:Anti-S-M6(1-2...

    Publication: 2419429;

  3. Localization of linear B-cell epitopes on infectious bronchitis virus nucleocapsid protein.

    ID: 1466517

    Description: epitope description:YPLRFSDGGPDGNFRWDFIPLNRGRSGRSTAASSAAASRAP antigen name:Nucleoprotein host organism:Gallus gallus

    Publication: 10865148;

  4. Localization of linear B-cell epitopes on infectious bronchitis virus nucleocapsid protein.

    ID: 1466521

    Description: epitope description:DLIARAAKIIQDQQKKGSRITKAKADEMAHRRYCKRTIPPNYRVDQV antigen name:Nucleoprotein host organism:Gallus gallus

    Publication: 10865148;

  5. Localization of linear B-cell epitopes on infectious bronchitis virus nucleocapsid protein.

    ID: 1466523

    Description: epitope description:DGRVTAMLNLVPSSHACLFGSRVTPKLQLDGLH antigen name:Nucleoprotein host organism:Gallus gallus

    Publication: 10865148;

  6. Identification of type-specific linear epitopes in the glycoproteins gp46 and gp21 of human T-cell leukemia viruses type I and type II using synthetic...

    ID: 1466539

    Description: epitope description:FSKCGFPFSLLVDAPGYDPIWFL antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 1712105;

  7. Identification of type-specific linear epitopes in the glycoproteins gp46 and gp21 of human T-cell leukemia viruses type I and type II using synthetic...

    ID: 1466548

    Description: epitope description:QHDVNFTQEVSRLNINLHFSKCG antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 1712105;

  8. Identification of type-specific linear epitopes in the glycoproteins gp46 and gp21 of human T-cell leukemia viruses type I and type II using synthetic...

    ID: 1466549

    Description: epitope description:PIWFLNTEPSQLPPTAPPLLPHS antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 1712105;

  9. Identification of type-specific linear epitopes in the glycoproteins gp46 and gp21 of human T-cell leukemia viruses type I and type II using synthetic...

    ID: 1466551

    Description: epitope description:LALSADQALQPPCPNLVSYSSYH antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 1712105;

  10. Protective and nonprotective epitopes of chemically synthesized peptides of the NH2-terminal region of type 6 streptococcal M protein.

    ID: 1466553

    Description: epitope description:RVFPRGTVENPDKARELLNK antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus New Zealand White antibody name:Anti-S-M6(10-...

    Publication: 2419429;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston