Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Studies on a species-specific epitope in murine, ovine and bovine prion protein.

    ID: 1280363

    Description: epitope description:WGQGGTHGQWNKPSK antigen name:Major prion protein host organism:Oryctolagus cuniculus Chinchilla antibody name:RaIV/2

    Publication: 7687651;

  2. Studies on a species-specific epitope in murine, ovine and bovine prion protein.

    ID: 1280368

    Description: epitope description:MERVVEQMCVTQYQKESQAY antigen name:Major prion protein host organism:Oryctolagus cuniculus Chinchilla antibody name:Ra7

    Publication: 7687651;

  3. Artificial mosaic protein containing antigenic epitopes of hepatitis E virus.

    ID: 1280413

    Description: epitope description:DYDNQHEQDRPTPSPAPSR antigen name:Capsid protein host organism:Cavia porcellus

    Publication: 7523696;

  4. Artificial mosaic protein containing antigenic epitopes of hepatitis E virus.

    ID: 1280417

    Description: epitope description:PSAPPLPPVADLPQPGLRR antigen name:Protein ORF3 host organism:Cavia porcellus

    Publication: 7523696;

  5. Artificial mosaic protein containing antigenic epitopes of hepatitis E virus.

    ID: 1280428

    Description: epitope description:ANPPDHSAPLGVTRPSAPPL antigen name:Protein ORF3 host organism:Cavia porcellus

    Publication: 7523696;

  6. Artificial mosaic protein containing antigenic epitopes of hepatitis E virus.

    ID: 1280443

    Description: epitope description:ANQPGHLAPLGEIRPSAPPL antigen name:Protein ORF3 host organism:Cavia porcellus

    Publication: 7523696;

  7. Artificial mosaic protein containing antigenic epitopes of hepatitis E virus.

    ID: 1280444

    Description: epitope description:ANQPGHLAPLGEIRPSAPPL antigen name:Protein ORF3 host organism:Cavia porcellus

    Publication: 7523696;

  8. Studies on a species-specific epitope in murine, ovine and bovine prion protein.

    ID: 1280448

    Description: epitope description:WGQGGTHGQWNKPSK antigen name:Major prion protein host organism:Oryctolagus cuniculus Chinchilla antibody name:RaIV/2

    Publication: 7687651;

  9. Mimicry between the hepatitis C virus polyprotein and antigenic targets of nuclear and smooth muscle antibodies in chronic hepatitis C virus infection...

    ID: 1280461

    Description: epitope description:KNQVEGEVQIVSTATQTFLA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 12930368;

  10. Mimicry between the hepatitis C virus polyprotein and antigenic targets of nuclear and smooth muscle antibodies in chronic hepatitis C virus infection...

    ID: 1280463

    Description: epitope description:VARALAHGVRVLEDGVNFAT antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 12930368;

  11. Mimicry between the hepatitis C virus polyprotein and antigenic targets of nuclear and smooth muscle antibodies in chronic hepatitis C virus infection...

    ID: 1280465

    Description: epitope description:LLISQAEAALENLVILNAAS antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 12930368;

  12. Mimicry between the hepatitis C virus polyprotein and antigenic targets of nuclear and smooth muscle antibodies in chronic hepatitis C virus infection...

    ID: 1281721

    Description: epitope description:RLRSSVPGVRLLQDSVDFSL antigen name:Vimentin host organism:Homo sapiens

    Publication: 12930368;

  13. Mimicry between the hepatitis C virus polyprotein and antigenic targets of nuclear and smooth muscle antibodies in chronic hepatitis C virus infection...

    ID: 1281727

    Description: epitope description:ELDQENEAALENGIKNEENT antigen name:Matrin-3 (UniProt:P43243) host organism:Homo sapiens

    Publication: 12930368;

  14. Mimicry between the hepatitis C virus polyprotein and antigenic targets of nuclear and smooth muscle antibodies in chronic hepatitis C virus infection...

    ID: 1281730

    Description: epitope description:VARALAHGVRVLEDGVNFAT antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 12930368;

  15. Mimicry between the hepatitis C virus polyprotein and antigenic targets of nuclear and smooth muscle antibodies in chronic hepatitis C virus infection...

    ID: 1281737

    Description: epitope description:RLRSSVPGVRLLQDSVDFSL antigen name:Vimentin host organism:Homo sapiens

    Publication: 12930368;

  16. Antigenic regions within the hepatitis C virus envelope 1 and non-structural proteins: identification of an IgG3-restricted recognition site with the ...

    ID: 1281747

    Description: epitope description:TPGCVPCVREGNASRCWV antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7680297;

  17. Antigenic regions within the hepatitis C virus envelope 1 and non-structural proteins: identification of an IgG3-restricted recognition site with the ...

    ID: 1281749

    Description: epitope description:TPTVATRDGKLPATQLRR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7680297;

  18. Antigenic regions within the hepatitis C virus envelope 1 and non-structural proteins: identification of an IgG3-restricted recognition site with the ...

    ID: 1281753

    Description: epitope description:SVFLVGQLFTFSPRRHWT antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7680297;

  19. Antigenic regions within the hepatitis C virus envelope 1 and non-structural proteins: identification of an IgG3-restricted recognition site with the ...

    ID: 1281758

    Description: epitope description:VMAQLLRIPQAILDMIAG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7680297;

  20. Antigenic regions within the hepatitis C virus envelope 1 and non-structural proteins: identification of an IgG3-restricted recognition site with the ...

    ID: 1281759

    Description: epitope description:AILDMIAGAHWGVLAGIA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7680297;

  21. Antigenic regions within the hepatitis C virus envelope 1 and non-structural proteins: identification of an IgG3-restricted recognition site with the ...

    ID: 1281763

    Description: epitope description:GVDAETHVTGGSAGHTVS antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7680297;

  22. Antigenic regions within the hepatitis C virus envelope 1 and non-structural proteins: identification of an IgG3-restricted recognition site with the ...

    ID: 1281771

    Description: epitope description:DLEDRDRSELSPLLLTTT antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7680297;

  23. Sequence variation within botulinum neurotoxin serotypes impacts antibody binding and neutralization.

    ID: 1281788

    Description: epitope description:RLLSTFTEYIKNIINTSILNLRYESNHLIDLSRYASKINIGSKVNFDPIDKNQIQLFNLESSKIEVILKNAIVYNSMYENFSTSFWIRIPKYFNSISLNNEYTIINCMENNSGWKVSLNYGEIIWTLQDT...

    Publication: 16113261;

  24. HCV-NS3 and IgG-Fc crossreactive IgM in patients with type II mixed cryoglobulinemia and B-cell clonal proliferations.

    ID: 1281794

    Description: epitope description:VLVLNPSVAATLGFGAYMSK antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 16617326;

  25. Sequence variation within botulinum neurotoxin serotypes impacts antibody binding and neutralization.

    ID: 1281801

    Description: epitope description:RLLSTFTEYIKNIINTSILNLRYESNHLIDLSRYASKINIGSKVNFDPIDKNQIQLFNLESSKIEVILKNAIVYNSMYENFSTSFWIRIPKYFNSISLNNEYTIINCMENNSGWKVSLNYGEIIWTLQDT...

    Publication: 16113261;

  26. Sequence variation within botulinum neurotoxin serotypes impacts antibody binding and neutralization.

    ID: 1281805

    Description: epitope description:ALNDLCIKVNNWDLFFSPSEDNFTNDLNKGEEITSDTNIEAAEENISLDLIQQYYLTFNFDNEPENISIENLSSDIIGQLELMPNIERFPNGKKYELDKYTMFHYLRAQEFEHGKSRIALTNSVNEALLN...

    Publication: 16113261;

  27. Sequence variation within botulinum neurotoxin serotypes impacts antibody binding and neutralization.

    ID: 1281807

    Description: epitope description:ALNDLCIKVNNWDLFFSPSEDNFTNDLNKGEEITSDTNIEAAEENISLDLIQQYYLTFNFDNEPENISIENLSSDIIGQLELMPNIERFPNGKKYELDKYTMFHYLRAQEFEHGKSRIALTNSVNEALLN...

    Publication: 16113261;

  28. Sequence variation within botulinum neurotoxin serotypes impacts antibody binding and neutralization.

    ID: 1281809

    Description: epitope description:ALNDLCIKVNNWDLFFSPSEDNFTNDLNKGEEITSDTNIEAAEENISLDLIQQYYLTFNFDNEPENISIENLSSDIIGQLELMPNIERFPNGKKYELDKYTMFHYLRAQEFEHGKSRIALTNSVNEALLN...

    Publication: 16113261;

  29. Sequence variation within botulinum neurotoxin serotypes impacts antibody binding and neutralization.

    ID: 1281811

    Description: epitope description:PFVNKQFNYKDPVNGVDIAYIKIPNVGQMQPVKAFKIHNKIWVIPERDTFTNPEEGDLNPPPEAKQVPVSYYDSTYLSTDNEKDNYLKGVTKLFERIYSTDLGRMLLTSIVRGIPFWGGSTIDTELKVID...

    Publication: 16113261;

  30. Sequence variation within botulinum neurotoxin serotypes impacts antibody binding and neutralization.

    ID: 1281814

    Description: epitope description:PFVNKQFNYKDPVNGVDIAYIKIPNVGQMQPVKAFKIHNKIWVIPERDTFTNPEEGDLNPPPEAKQVPVSYYDSTYLSTDNEKDNYLKGVTKLFERIYSTDLGRMLLTSIVRGIPFWGGSTIDTELKVID...

    Publication: 16113261;

  31. Antigenic regions within the hepatitis C virus envelope 1 and non-structural proteins: identification of an IgG3-restricted recognition site with the ...

    ID: 1281821

    Description: epitope description:IIPDREVLYREFDEMEEC antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7680297;

  32. Antigenic regions within the hepatitis C virus envelope 1 and non-structural proteins: identification of an IgG3-restricted recognition site with the ...

    ID: 1281833

    Description: epitope description:NKRNTNRRPQDVKFPGGG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7680297;

  33. Antigenic regions within the hepatitis C virus envelope 1 and non-structural proteins: identification of an IgG3-restricted recognition site with the ...

    ID: 1281835

    Description: epitope description:KTSERSQPRGRRQPIPKA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7680297;

  34. HCV-NS3 and IgG-Fc crossreactive IgM in patients with type II mixed cryoglobulinemia and B-cell clonal proliferations.

    ID: 1281845

    Description: epitope description:AIPLEVIK antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 16617326;

  35. Bacterial cell surface display for epitope mapping of hepatitis C virus core antigen.

    ID: 1281848

    Description: epitope description:MSTNPKPQRKTKRNTNRRPQDVKFPG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 14553932;

  36. Identification of hepatitis C virus 1b-derived peptides recognized by both cellular and humoral immune systems in HCV1b(+) HLA-A24(+) patients.

    ID: 1286457

    Description: epitope description:AFYGVWPLL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 16095964;

  37. Identification of hepatitis C virus 1b-derived peptides recognized by both cellular and humoral immune systems in HCV1b(+) HLA-A24(+) patients.

    ID: 1286459

    Description: epitope description:LYGVWPLLL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 16095964;

  38. Identification of hepatitis C virus 1b-derived peptides recognized by both cellular and humoral immune systems in HCV1b(+) HLA-A24(+) patients.

    ID: 1286466

    Description: epitope description:TYVYDHLTPL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 16095964;

  39. Identification of hepatitis C virus 1b-derived peptides recognized by both cellular and humoral immune systems in HCV1b(+) HLA-A24(+) patients.

    ID: 1286472

    Description: epitope description:AYAAQGYKVL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 16095964;

  40. Identification of hepatitis C virus 1b-derived peptides recognized by both cellular and humoral immune systems in HCV1b(+) HLA-A24(+) patients.

    ID: 1286476

    Description: epitope description:EFWESVFTGL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 16095964;

  41. Identification of hepatitis C virus 1b-derived peptides recognized by both cellular and humoral immune systems in HCV1b(+) HLA-A24(+) patients.

    ID: 1286477

    Description: epitope description:QFKQKAIGL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 16095964;

  42. Identification of hepatitis C virus 1b-derived peptides recognized by both cellular and humoral immune systems in HCV1b(+) HLA-A24(+) patients.

    ID: 1286639

    Description: epitope description:PYIEQGMQL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 16095964;

  43. Isolation and characterization of monoclonal antibodies that inhibit hepatitis C virus NS3 protease.

    ID: 1288864

    Description: epitope description:DQDLV antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:8D4

    Publication: 10864639;

  44. Molecular specificities of antibodies against ovine and murine recombinant prion proteins.

    ID: 1288967

    Description: epitope description:THSQWNKPSKPKTNMK antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:8G8

    Publication: 11178966;

  45. Molecular specificities of antibodies against ovine and murine recombinant prion proteins.

    ID: 1288970

    Description: epitope description:GSDYEDRYYRENMHRYPNQ antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:12F10

    Publication: 11178966;

  46. Molecular specificities of antibodies against ovine and murine recombinant prion proteins.

    ID: 1288972

    Description: epitope description:CITQYERESQAYYQRGS antigen name:Major prion protein host organism:Mus musculus Biozzi antibody name:Pri 917

    Publication: 11178966;

  47. A monoclonal antibody to Bacillus anthracis protective antigen defines a neutralizing epitope in domain 1.

    ID: 1289281

    Description: epitope description:EVKQENRLLNESESSSQGLLGYYFSDLNFQAPMVVTSSTTGDLSIPSSELENIPSENQYFQSAIWSGFIKVKKSDEYTFATSADNHVTMWVDDQEVINKASNSNKIRLEKGRLYQIKIQYQRENPTEKGL...

    Publication: 16790789;

  48. Molecular specificities of antibodies against ovine and murine recombinant prion proteins.

    ID: 1289286

    Description: epitope description:THGQWNKPSKPKTNMK antigen name:Major prion protein host organism:Oryctolagus cuniculus antibody name:RB1

    Publication: 11178966;

  49. Molecular specificities of antibodies against ovine and murine recombinant prion proteins.

    ID: 1289289

    Description: epitope description:THNQWNKPSKPKTNLK antigen name:Major prion protein host organism:Oryctolagus cuniculus antibody name:RM1

    Publication: 11178966;

  50. Molecular specificities of antibodies against ovine and murine recombinant prion proteins.

    ID: 1289298

    Description: epitope description:GGWGQPHGGGWGQG antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:SAF 15

    Publication: 11178966;

  51. Mapping of serotype-specific, immunodominant epitopes in the NS-4 region of hepatitis C virus (HCV): use of type-specific peptides to serologically di...

    ID: 1289311

    Description: epitope description:SGKPAIIPD antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7686182;

  52. Mapping of serotype-specific, immunodominant epitopes in the NS-4 region of hepatitis C virus (HCV): use of type-specific peptides to serologically di...

    ID: 1289319

    Description: epitope description:DREVLYREF antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7686182;

  53. Mapping of serotype-specific, immunodominant epitopes in the NS-4 region of hepatitis C virus (HCV): use of type-specific peptides to serologically di...

    ID: 1289325

    Description: epitope description:REFDEMEEC antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7686182;

  54. Mapping of serotype-specific, immunodominant epitopes in the NS-4 region of hepatitis C virus (HCV): use of type-specific peptides to serologically di...

    ID: 1289326

    Description: epitope description:EFDEMEECS antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7686182;

  55. Mapping of serotype-specific, immunodominant epitopes in the NS-4 region of hepatitis C virus (HCV): use of type-specific peptides to serologically di...

    ID: 1289328

    Description: epitope description:DEMEECSQH antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7686182;

  56. Mapping of serotype-specific, immunodominant epitopes in the NS-4 region of hepatitis C virus (HCV): use of type-specific peptides to serologically di...

    ID: 1289333

    Description: epitope description:ECSQHLPYI antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7686182;

  57. Mapping of protective and cross-reactive domains of the type A neurotoxin of Clostridium botulinum.

    ID: 1276448

    Description: epitope description:LNSSLYRGTKFIIKKYASGNKDNIVRNNDRVYINVVVKNKEYRLATNASQAGVEKILSALEIPDVGNLSQVVVMKSKNDQGITNKCKMNLQDNNGNDIGFIGFHQFNNIAKLVASNWYNRQIERSSRTLG...

    Publication: 9014296;

  58. Selective and efficient immunoprecipitation of the disease-associated form of the prion protein can be mediated by nonspecific interactions between mo...

    ID: 1276466

    Description: epitope description:HMAGAAAA antigen name:Major prion protein host organism:Mus musculus Biozzi antibody name:Pri-308

    Publication: 15140886;

  59. Selective and efficient immunoprecipitation of the disease-associated form of the prion protein can be mediated by nonspecific interactions between mo...

    ID: 1276467

    Description: epitope description:TQYERE antigen name:Major prion protein host organism:Mus musculus Biozzi antibody name:Pri-917

    Publication: 15140886;

  60. Selective and efficient immunoprecipitation of the disease-associated form of the prion protein can be mediated by nonspecific interactions between mo...

    ID: 1276468

    Description: epitope description:RYPNQVYYRPV antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:Bar-234

    Publication: 15140886;

  61. Selective and efficient immunoprecipitation of the disease-associated form of the prion protein can be mediated by nonspecific interactions between mo...

    ID: 1276471

    Description: epitope description:DYEDRYYREN antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:SAF-53, SAF-61

    Publication: 15140886;

  62. Peptide immunogen mimicry of putative E1 glycoprotein-specific epitopes in hepatitis C virus.

    ID: 1276617

    Description: epitope description:SSIVYEAADMIMHT antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 8207814;

  63. Peptides derived from the unique region of B19 parvovirus minor capsid protein elicit neutralizing antibodies in rabbits.

    ID: 1276621

    Description: epitope description:NISLDNPLENPSSLFDLVARIK antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus

    Publication: 7530397;

  64. Applicability of three anti-PrP peptide sera including staining of tonsils and brainstem of sheep with scrapie.

    ID: 1276645

    Description: epitope description:GSAMSRPLIHFGN antigen name:Major prion protein host organism:Oryctolagus cuniculus New Zealand White antibody name:R521

    Publication: 10871546;

  65. Applicability of three anti-PrP peptide sera including staining of tonsils and brainstem of sheep with scrapie.

    ID: 1276646

    Description: epitope description:GQGGSHSQWNKPSKPKTNMK antigen name:Major prion protein host organism:Oryctolagus cuniculus New Zealand White antibody name:R505

    Publication: 10871546;

  66. Applicability of three anti-PrP peptide sera including staining of tonsils and brainstem of sheep with scrapie.

    ID: 1276649

    Description: epitope description:WSDVGLCKKRPKP antigen name:Major prion protein host organism:Oryctolagus cuniculus New Zealand White antibody name:1B3

    Publication: 10871546;

  67. Peptides derived from the unique region of B19 parvovirus minor capsid protein elicit neutralizing antibodies in rabbits.

    ID: 1276670

    Description: epitope description:PGTNYVGPGNELQAGPPQSAVD antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus

    Publication: 7530397;

  68. Peptides derived from the unique region of B19 parvovirus minor capsid protein elicit neutralizing antibodies in rabbits.

    ID: 1276675

    Description: epitope description:PQSAVDSAARIHDFRYSQLAKL antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus

    Publication: 7530397;

  69. Peptides derived from the unique region of B19 parvovirus minor capsid protein elicit neutralizing antibodies in rabbits.

    ID: 1276681

    Description: epitope description:ADEELLKNIKNETGFQAQVVKD antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus

    Publication: 7530397;

  70. Peptides derived from the unique region of B19 parvovirus minor capsid protein elicit neutralizing antibodies in rabbits.

    ID: 1276687

    Description: epitope description:AQVVKDYFTLKGAAAPVAHFQG antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus

    Publication: 7530397;

  71. Peptides derived from the unique region of B19 parvovirus minor capsid protein elicit neutralizing antibodies in rabbits.

    ID: 1276696

    Description: epitope description:SEKYPSMTSVNSAEASTGAGGG antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus

    Publication: 7530397;

  72. Peptides derived from the unique region of B19 parvovirus minor capsid protein elicit neutralizing antibodies in rabbits.

    ID: 1276699

    Description: epitope description:TGAGGGGSNSVKSMWSEGATFS antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus

    Publication: 7530397;

  73. Peptides derived from the unique region of B19 parvovirus minor capsid protein elicit neutralizing antibodies in rabbits.

    ID: 1276700

    Description: epitope description:TGAGGGGSNSVKSMWSEGATFS antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus

    Publication: 7530397;

  74. Conformational variation between allelic variants of cell-surface ovine prion protein.

    ID: 1276711

    Description: epitope description:PVDQY antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:683, 884

    Publication: 15070397;

  75. Identification of a cytoplasmic region of the Torpedo nicotinic acetylcholine receptor alpha-subunit by epitope mapping.

    ID: 1276716

    Description: epitope description:LSTFMESGEWVMK antigen name:Acetylcholine receptor subunit alpha host organism:Mus musculus antibody name:A14

    Publication: 1688436;

  76. Epitope mapping of the NS4 and NS5 gene products of hepatitis C virus and the use of a chimeric NS4-NS5 synthetic peptide for serodiagnosis.

    ID: 1276718

    Description: epitope description:FDPLVAEE antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8537460;

  77. Epitope mapping of the NS4 and NS5 gene products of hepatitis C virus and the use of a chimeric NS4-NS5 synthetic peptide for serodiagnosis.

    ID: 1276720

    Description: epitope description:PLVAEEDE antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8537460;

  78. Epitope mapping of the NS4 and NS5 gene products of hepatitis C virus and the use of a chimeric NS4-NS5 synthetic peptide for serodiagnosis.

    ID: 1276724

    Description: epitope description:EREVSVPA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8537460;

  79. Epitope mapping of the NS4 and NS5 gene products of hepatitis C virus and the use of a chimeric NS4-NS5 synthetic peptide for serodiagnosis.

    ID: 1276726

    Description: epitope description:VPAEILRK antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8537460;

  80. Epitope mapping of the NS4 and NS5 gene products of hepatitis C virus and the use of a chimeric NS4-NS5 synthetic peptide for serodiagnosis.

    ID: 1276729

    Description: epitope description:ILRKSRRF antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8537460;

  81. Epitope mapping of the NS4 and NS5 gene products of hepatitis C virus and the use of a chimeric NS4-NS5 synthetic peptide for serodiagnosis.

    ID: 1276734

    Description: epitope description:PALPVWAR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8537460;

  82. Epitope mapping of the NS4 and NS5 gene products of hepatitis C virus and the use of a chimeric NS4-NS5 synthetic peptide for serodiagnosis.

    ID: 1276735

    Description: epitope description:ALPVWARP antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8537460;

  83. Epitope mapping of the NS4 and NS5 gene products of hepatitis C virus and the use of a chimeric NS4-NS5 synthetic peptide for serodiagnosis.

    ID: 1276739

    Description: epitope description:WARPDYNP antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8537460;

  84. Epitope mapping of the NS4 and NS5 gene products of hepatitis C virus and the use of a chimeric NS4-NS5 synthetic peptide for serodiagnosis.

    ID: 1276744

    Description: epitope description:YNPLLVET antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8537460;

  85. Epitope mapping of the NS4 and NS5 gene products of hepatitis C virus and the use of a chimeric NS4-NS5 synthetic peptide for serodiagnosis.

    ID: 1276750

    Description: epitope description:ETWKKPDY antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8537460;

  86. Epitope mapping of the NS4 and NS5 gene products of hepatitis C virus and the use of a chimeric NS4-NS5 synthetic peptide for serodiagnosis.

    ID: 1276753

    Description: epitope description:KKPDYEPP antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8537460;

  87. Epitope mapping of the NS4 and NS5 gene products of hepatitis C virus and the use of a chimeric NS4-NS5 synthetic peptide for serodiagnosis.

    ID: 1276763

    Description: epitope description:AEILRKSR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8537460;

  88. Epitope mapping of the NS4 and NS5 gene products of hepatitis C virus and the use of a chimeric NS4-NS5 synthetic peptide for serodiagnosis.

    ID: 1276765

    Description: epitope description:KSRRFAPA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8537460;

  89. Epitope mapping of the NS4 and NS5 gene products of hepatitis C virus and the use of a chimeric NS4-NS5 synthetic peptide for serodiagnosis.

    ID: 1276769

    Description: epitope description:EPPVVHGC antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8537460;

  90. Epitope mapping of the NS4 and NS5 gene products of hepatitis C virus and the use of a chimeric NS4-NS5 synthetic peptide for serodiagnosis.

    ID: 1276773

    Description: epitope description:GLLQTASRHAEVITPAVQTN antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8537460;

  91. Immunodominant antigenic regions in a structural protein of the hepatitis E virus.

    ID: 1276786

    Description: epitope description:QLFYSRPVVSANGEPTVKLY antigen name:Capsid protein host organism:Homo sapiens

    Publication: 8259678;

  92. Immunodominant antigenic regions in a structural protein of the hepatitis E virus.

    ID: 1276792

    Description: epitope description:DWTKVTLDGRPLSTIQ antigen name:Capsid protein host organism:Homo sapiens

    Publication: 8259678;

  93. Immunodominant antigenic regions in a structural protein of the hepatitis E virus.

    ID: 1276796

    Description: epitope description:ISSAGGQLFYSRPVVSANGE antigen name:Capsid protein host organism:Homo sapiens

    Publication: 8259678;

  94. Immunodominant antigenic regions in a structural protein of the hepatitis E virus.

    ID: 1276798

    Description: epitope description:QLFYSRPVVSANGEPTVKLY antigen name:Capsid protein host organism:Homo sapiens

    Publication: 8259678;

  95. Immunodominant antigenic regions in a structural protein of the hepatitis E virus.

    ID: 1276812

    Description: epitope description:SLTAAEYDQSTYGSSTGPVY antigen name:Capsid protein host organism:Homo sapiens

    Publication: 8259678;

  96. Immunodominant antigenic regions in a structural protein of the hepatitis E virus.

    ID: 1276816

    Description: epitope description:NAQQDKGIAIPHDIDLGESR antigen name:Capsid protein host organism:Homo sapiens

    Publication: 8259678;

  97. Immunodominant antigenic regions in a structural protein of the hepatitis E virus.

    ID: 1276828

    Description: epitope description:SPAPSRPFSVLRANDVLWLS antigen name:Capsid protein host organism:Homo sapiens

    Publication: 8259678;

  98. Peptide immunogen mimicry of putative E1 glycoprotein-specific epitopes in hepatitis C virus.

    ID: 1276829

    Description: epitope description:SSIVYEAADMIMHT antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 8207814;

  99. Identification and characterization of novel neutralizing epitopes in the receptor-binding domain of SARS-CoV spike protein: revealing the critical an...

    ID: 1276862

    Description: epitope description:D429, R441, E452, D454 antigen name:Spike glycoprotein host organism:Mus musculus BALB/c antibody name:S6, S37, S50

    Publication: 16725238;

  100. Identification and characterization of novel neutralizing epitopes in the receptor-binding domain of SARS-CoV spike protein: revealing the critical an...

    ID: 1276871

    Description: epitope description:D429, R441, D454, D463 antigen name:Spike glycoprotein host organism:Mus musculus BALB/c antibody name:MAb S53

    Publication: 16725238;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston